Basic Vector Information
- Vector Name:
- pCAM-PROM
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10110 bp
- Type:
- Plant transformation vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Dutt M, Ananthakrishnan G, Jaromin MK, Brlansky RH, Grosser JW.
- Promoter:
- NOS
pCAM-PROM vector Map
pCAM-PROM vector Sequence
LOCUS 40924_8651 10110 bp DNA circular SYN 17-DEC-2018 DEFINITION Plant transformation vector pCAM-PROM, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10110) AUTHORS Dutt M, Ananthakrishnan G, Jaromin MK, Brlansky RH, Grosser JW. TITLE Evaluation of four phloem-specific promoters in vegetative tissues of transgenic citrus plants JOURNAL Tree Physiol. 32 (1), 83-93 (2012) PUBMED 22228816 REFERENCE 2 (bases 1 to 10110) AUTHORS Dutt M, Ananthakrishnan G, Jaromin M, Brlansky R, Grosser J. TITLE Direct Submission JOURNAL Submitted (29-FEB-2012) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA REFERENCE 3 (bases 1 to 10110) TITLE Direct Submission REFERENCE 4 (bases 1 to 10110) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Tree Physiol."; date: "2012"; volume: "32"; issue: "1"; pages: "83-93" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-FEB-2012) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10110 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 41..1849 /codon_start=1 /gene="gus" /product="GUS" /label=gus /protein_id="AFM76958.1" /translation="MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWVNNQEV MEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQSYFHD FFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDADQQ VVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAVKGQQF LINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAEEMLDW ADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARD KNHPSVVMWSIANEPDTRPQVHGNISPLAEATRKLDPTRPITCVNVMFCDAHTDTISDL FDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAGLHSMYT DMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKP KSAAFLLQKRWTGMNFGEKPQQGGKQ" gene 41..1849 /gene="gus" /label=gus regulatory 1864..2154 /label=35S - 3' /note="35S - 3'" /regulatory_class="terminator" polyA_signal 1908..2082 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" promoter 2284..2467 /label=NOS promoter /note="nopaline synthase promoter" CDS 2485..3273 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 3333..3507 /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" misc_feature complement(3585..3609) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 4034..4825 /label=KanR /note="aminoglycoside phosphotransferase" rep_origin 4915..5503 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5689..5829) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(6173..6367) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(6436..7500) /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7937..8563) /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature complement(9863..9887) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 10090..10106 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.