Basic Vector Information
- Vector Name:
- pCAhIFNGSTm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6738 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAhIFNGSTm vector Vector Map
pCAhIFNGSTm vector Sequence
LOCUS V008780 6738 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008780 VERSION V008780 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6738) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6738) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6738) TITLE Direct Submission REFERENCE 4 (bases 1 to 6738) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6738 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 69..137 /codon_start=1 /note="unnamed protein product; hIFNG signal sequence" /protein_id="SJL87797.1" /translation="MKYTSYILAFQLCIVLGSLGCYC" CDS 149..1211 /codon_start=1 /note="unnamed protein product; mature hST6GalI mutant" /protein_id="SJL87798.1" /translation="GRHGV*FPVCILKQHPGPPQGPPDPRQSQRPSQGQTRGLLPGVEQ GQLFQKPYP*AAKDLEELPKHEQVQSVLQGARTRHQVQCRGPALPPPGPCECIHGRGHR FSLQYL*MGGLSAQGEH*DQGWALGQVCCCVVSGISEVLPTRQRNR*S*RSPEV*WGTH SQLPTRCGHKNYHSPDELSVGYHREALPQRQFVQ*RNPNCMGPICIPLRYPKVVPESGL *FL*QLQDLS*AAPQSALLHPQAPDALGAMGHSSRNLPRRDSAKPPILWDAWYHHHDDA V*PGGYL*VPPIQAQD*RVLLLPEVLR*CLHDGCLPPAAL*EEFGEASQPGHR*GHLPA WKSHTAWLPDHSLL" regulatory 150..159 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 1265..1684 /gene="IFNG" /label="Interferon gamma" /note="Interferon gamma from Pan troglodytes. Accession#: Q9TTB0" polyA_signal 2095..2150 /label="beta-globin poly(A) signal" /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(2511..2527) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2535..2551) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2559..2589) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(2603..2624) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." promoter 2682..2878 /label="SV40 promoter" /note="SV40 early promoter" polyA_signal 2884..3018 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" rep_origin complement(3256..3844) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4018..4875) /label="AmpR" /note="beta-lactamase" promoter complement(4876..4980) /label="AmpR promoter" enhancer 5011..5390 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" regulatory 5011..5388 /label="hCMV-IE enhancer" /note="hCMV-IE enhancer" /regulatory_class="promoter" promoter 5392..5669 /label="chicken beta-actin promoter" intron 5670..6687 /label="chimeric intron" /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.