Basic Vector Information
- Vector Name:
- pCAGGS-TAX1BP1-L
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7189 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-TAX1BP1-L vector Map
pCAGGS-TAX1BP1-L vector Sequence
LOCUS 40924_8506 7189 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-TAX1BP1-L, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7189) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 7189) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 7189) TITLE Direct Submission REFERENCE 4 (bases 1 to 7189) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7189 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 92..2335 /codon_start=1 /note="unnamed protein product; hTAX1BP1-L" /protein_id="SJL88026.1" /translation="MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPH PKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCY VTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEE LLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKGLTEVTQSLKMENEEFKK RFSDATSKAHQLEEDIVSVTHKAIEKETELDSLKDKLKKAQHEREQLECQLKTEKDEKE LYKVHLKNTEIENTKLMSEVQTLKNIDGNKESVITHFKEEIGRLQLCLAEKENLQRTFL LTTSSKEDTCFLKEQLRKAEEQVQATRQEVVFLAKELSDAVNVRDRTMADLHTARLENE KVKKQLADAVAELKLNAMKKDQDKTDTLEHELRREVEDLKLRLQMAADHYKEKFKECQR LQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFD IVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENV KLELAEVQDNYKELKRSLENPAERKMEDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQ PARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELM FPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD" polyA_signal 2544..2599 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(2960..2976) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2984..3000) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3008..3038) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3052..3073) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3131..3327 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 3333..3467 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3705..4293) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4467..5324) /label=AmpR /note="beta-lactamase" promoter complement(5325..5429) /label=AmpR promoter enhancer 5464..5843 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" regulatory 5464..5841 /label=hCMV-IE enhancer /note="hCMV-IE enhancer" /regulatory_class="promoter" promoter 5845..6122 /label=chicken beta-actin promoter intron 6123..7140 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.