Basic Vector Information
- Vector Name:
- pCAGGS-prepro-TSE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8321 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-prepro-TSE vector Vector Map
pCAGGS-prepro-TSE vector Sequence
LOCUS 40924_8496 8321 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-prepro-TSE, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8321) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 8321) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 8321) TITLE Direct Submission REFERENCE 4 (bases 1 to 8321) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8321 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 428..694 /label=alpha-factor secretion signal /note="N-terminal secretion signal from S. cerevisiae alpha-factor" CDS 698..2629 /codon_start=1 /note="unnamed protein product; mature TS" /protein_id="SJL88095.1" /translation="MLAPGSSRVELFKRKNSTVPFEDKAGKVTERVVHSFRLPALVNVD GVMVAIADARYDTSNDNSLIDTVAKYSVDDGETWETQIAIKNSRVSSVSRVVDPTVIVK GNKLYVLVGSYYSSRSYWSSHGDARDWDILLAVGEVTKSIAGGKITASIKWGSPVSLKK FFPAEMEGMHTNQFLGGAGVAIVASNGNLVYPVQVTNKRKQVFSKIFYSEDDGKTWKFG KGRSDFGCSEPVALEWEGKLIINTRVDWKRRLVYESSDMGNTWVEAVGTLSRVWGPSPK SDHPGSQSSFTAVTIEGMRVMLFTHPLNFKGRWLRDRLNLWLTDNQRIYNVGQVSIGDE NSAYSSVLYKDDKLYCLHEINTDEVYSLVFARLVGELRIIKSVLRSWKNWDSHLSSICT PADPAASSSESGCGPAVTTVGLVGFLSGNASQNVWEDAYRCVNASTANAERVRNGLKFA GVGGGALWPVSQQGQNQRYRFANHAFTLVASVTIHEAPRAASPLLGASLDSSGGKKLLG LSYDEKHQWQPIYGSTPVTPTGSWETGKRYHVVLTVANKIGSVYIDGELLEGSGQTVVP DGRTPDISHFYVGGYGRSDMPTISHVTVNNVLLYNRQLNTEEIRTLFLSQDLIGTEAHM DSSSDTKEL" misc_feature 2630..2668 /label=E-tag /note="E-tag" polyA_signal 3678..3733 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(4094..4110) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4118..4134) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4142..4172) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4186..4207) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4265..4461 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 4467..4601 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(4839..5427) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5601..6458) /label=AmpR /note="beta-lactamase" promoter complement(6459..6563) /label=AmpR promoter regulatory 6591..6971 /label=hCMV enhancer /note="hCMV enhancer" /regulatory_class="promoter" enhancer 6594..6973 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 6975..7252 /label=chicken beta-actin promoter intron 7253..8270 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.