pCAGGS-mCASP-1p10HA vector (V008813)

Basic Vector Information

Vector Name:
pCAGGS-mCASP-1p10HA
Antibiotic Resistance:
Ampicillin
Length:
5058 bp
Type:
Mammalian expression vector
Replication origin:
ori
Source/Author:
De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
Promoter:
CAG

pCAGGS-mCASP-1p10HA vector Vector Map

pCAGGS-mCASP-1p10HA5058 bp6001200180024003000360042004800unnamed protein product; mCASP-1, p10 subunitHAbeta-globin poly(A) signalM13 revlac operatorlac promoterCAP binding siteSV40 promoterSV40 poly(A) signaloriAmpRAmpR promoterCMV enhancerchicken beta-actin promoterchimeric intron

pCAGGS-mCASP-1p10HA vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_8446        5058 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Mammalian expression vector pCAGGS-mCASP-1p10HA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5058)
  AUTHORS   De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman 
            Fonseca M, Vanhoucke M, Beyaert R.
  TITLE     BCCM/LMBP Plasmid collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 5058)
  AUTHORS   De Schamphelaire W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, 
            Technologiepark 927, 9052, BELGIUM
REFERENCE   3  (bases 1 to 5058)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5058)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 
            9052, BELGIUM"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5058
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             10..276
                     /codon_start=1
                     /note="unnamed protein product; mCASP-1, p10 subunit"
                     /protein_id="SJL87735.1"
                     /translation="MGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEY
                     AWSCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH"
     CDS             286..312
                     /label=HA
                     /note="HA (human influenza hemagglutinin) epitope tag"
     polyA_signal    415..470
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     primer_bind     complement(831..847)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(855..871)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(879..909)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(923..944)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        1002..1198
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     polyA_signal    1204..1338
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1576..2164)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2338..3195)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3196..3300)
                     /label=AmpR promoter
     enhancer        3331..3710
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     regulatory      3331..3708
                     /label=hCMV-IE enhancer
                     /note="hCMV-IE enhancer"
                     /regulatory_class="promoter"
     promoter        3712..3989
                     /label=chicken beta-actin promoter
     intron          3990..5007
                     /label=chimeric intron
                     /note="chimera between introns from chicken beta-actin and
                     rabbit beta-globin"

This page is informational only.