Basic Vector Information
- Vector Name:
- pCAGGS-mCASP-1fa
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5108 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-mCASP-1fa vector Map
pCAGGS-mCASP-1fa vector Sequence
LOCUS 40924_8441 5108 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-mCASP-1fa, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5108) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5108) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5108) TITLE Direct Submission REFERENCE 4 (bases 1 to 5108) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5108 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(1..256) /codon_start=1 /note="unnamed protein product; CASP1f" /protein_id="SJL88365.1" /translation="MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKL ANITAMDKARDLCDHVSKKGPQASQIFITYICNEDCYLAG" misc_feature complement(257..319) /label=5UTR /note="5UTR" polyA_signal 465..520 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(881..897) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(905..921) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(929..959) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(973..994) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 1052..1248 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 1254..1388 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1626..2214) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2388..3245) /label=AmpR /note="beta-lactamase" promoter complement(3246..3350) /label=AmpR promoter enhancer 3381..3760 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" misc_feature 3381..3758 /label=hCMV /note="hCMV" promoter 3762..4039 /label=chicken beta-actin promoter intron 4040..5057 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.