Basic Vector Information
- Vector Name:
- pCAGGS-FLAGmA20f6
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6871 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-FLAGmA20f6 vector Map
pCAGGS-FLAGmA20f6 vector Sequence
LOCUS 40924_8391 6871 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-FLAGmA20f6, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6871) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6871) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6871) TITLE Direct Submission REFERENCE 4 (bases 1 to 6871) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6871 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 13..36 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 46..2142 /codon_start=1 /note="unnamed protein product; mA20 (1-699)" /protein_id="SJL88016.1" /translation="MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHR YTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCL MHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRN WNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGS NFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRG RFEDLKVHFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEIN LVDDYFELVQHEYKKWQENSDQARRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVN TQPLCHECSERRQKNQSKLPKLNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPS LFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHARQINASHTADPGKCQACLQDVTRTF NGICSTCFKRTTAEPSSSLTSSIPASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCL SQAARTPGDRAGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASAKAGSPAPR FQNNVPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEARRTEEQLRSSQHRDMPRTTQ VASRL" polyA_signal 2224..2279 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(2640..2656) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2664..2680) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2688..2718) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2732..2753) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2811..3007 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 3013..3147 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3385..3973) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4147..5004) /label=AmpR /note="beta-lactamase" promoter complement(5005..5109) /label=AmpR promoter enhancer 5144..5523 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" regulatory 5144..5521 /label=hCMV-IE enhancer /note="hCMV-IE enhancer" /regulatory_class="promoter" promoter 5525..5802 /label=chicken beta-actin promoter intron 5803..6820 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.