Basic Vector Information
- Vector Name:
- pCAGGS-E-hPTBdelnls
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6373 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-E-hPTBdelnls vector Map
pCAGGS-E-hPTBdelnls vector Sequence
LOCUS 40924_8141 6373 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-E-hPTBdelnls, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6373) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6373) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6373) TITLE Direct Submission REFERENCE 4 (bases 1 to 6373) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6373 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 11..49 /label=E-tag /note="E-tag" CDS 59..1570 /codon_start=1 /note="unnamed protein product; hPTBdelnls" /protein_id="SJL87136.1" /translation="MVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFI EMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQ SGNLALAASAAAVDAGMAMAGQSPVLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFT KNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYT RPDLPSGDSQPSLDQTMAAAFGAPGIISASPYAGAGFPPTFAIPQAAGLSVPNVHGALA PLAIPSAAAAAAAAGRIAIPGLAGAGNSVLLVSNLNPERVTPQSLFILFGVYGDVQRVK ILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQLPREGQEDQGLT KDYGNSPLHRFKKPGSKNFQNIFPPSATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFKF FQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI" polyA_signal 1725..1780 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(2141..2157) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2165..2181) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2189..2219) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2233..2254) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2312..2508 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 2514..2648 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2886..3474) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3648..4505) /label=AmpR /note="beta-lactamase" promoter complement(4506..4610) /label=AmpR promoter enhancer 4641..5020 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" regulatory 4641..5018 /label=hCMV-IE enhancer /note="hCMV-IE enhancer" /regulatory_class="promoter" promoter 5022..5299 /label=chicken beta-actin promoter intron 5300..6317 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.