pC35-STDBxb1 vector (V008955)

Download GeneBank File(.gb)

LOCUS       40924_7941       12759 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Chloroplast transformation vector pC35-STDBxb1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12759)
  AUTHORS   Shao M, Kumar S, Thomson JG.
  TITLE     Precise excision of plastid DNA by the large serine recombinase Bxb1
  JOURNAL   Plant Biotechnol. J. (2013) In press
  PUBMED    24261912
REFERENCE   2  (bases 1 to 12759)
  AUTHORS   Shao M, Kumar S, Thomson JG.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2013) Crop Improvement and Utilization, USDA, 800 
            Buchanan Street, Albany, CA 94710, USA
REFERENCE   3  (bases 1 to 12759)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 12759)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant 
            Biotechnol. J. (2013) In press"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (09-SEP-2013) Crop Improvement and Utilization, USDA, 800 Buchanan 
            Street, Albany, CA 94710, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..12759
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    complement(82..106)
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     primer_bind     309..325
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        1571..1914
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     CDS             1938..3620
                     /codon_start=1
                     /gene="STDBxb1"
                     /product="STDBxb1"
                     /label=STDBxb1
                     /note="Bxb1 large serine recombinase/integrase from 
                     Mycobacterium smegmati bacteriophage Bxb1; similar to INSD 
                     Accession Number JQ305141.1; stroma targeting domain (STD) 
                     fused to Bxb1 large serine recombinase"
                     /protein_id="AHB17669.1"
                     /translation="MASSLLSSAAVATRSNVAQANMVAPFTGLKSAASFPVSRKQNLDI
                     TSIASNGGRVQCMLINRALVVIRLSRVTDATTSPERQLESCQQLCAQRGWDVVGVAEDL
                     DVSGAVDPFDRKRRPNLARWLAFEEQPFDVIVAYRVDRLTRSIRHLQQLVHWAEDHKKL
                     VVSATEAHFDTTTPFAAVVIALMGTVAQMELEAIKERNRSAAHFNIRAGKYRGSLPPWG
                     YLPTRVDGEWRLVPDPVQRERILEVYHRVVDNHEPLHLVAHDLNRRGVLSPKDYFAQLQ
                     GREPQGREWSATALKRSMISEAMLGYATLNGKTVRDDDGAPLVRAEPILTREQLEALRA
                     ELVKTSRAKPAVSTPSLLLRVLFCAVCGEPAYKFAGGGRKHPRYRCRSMGFPKHCGNGT
                     VAMAEWDAFCEEQVLDLLGDAERLEKVWVAGSDSAVELAEVNAELVDLTSLIGSPAYRA
                     GSPQREALDARIAALAARQEELEGLEARPSGWEWRETGQRFGDWWREQDTAAKNTWLRS
                     MNVRLTFDVRGGLTRTIDFGDLQEYEQHLRLGSVVERLHTGMS"
     gene            1938..3620
                     /gene="STDBxb1"
                     /label=STDBxb1
     sig_peptide     1938..2111
                     /gene="STDBxb1"
                     /note="tobacco gene for ribulose 1,5-bisphosphate
                     carboxylase small subunit stroma targeting domain (STD); 
                     similar to INSD Accession Number X02353.1"
     terminator      3795..4047
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     primer_bind     complement(4411..4427)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    4435..4451
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4459..4489)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4504..4525)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        4716..5393
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     CDS             5462..6250
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    6310..6484
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     misc_feature    complement(6562..6586)
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     CDS             7011..7802
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      7892..8480
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(8666..8806)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(9150..9344)
                     /direction=LEFT
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(9413..10477)
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     CDS             complement(10914..11540)
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"