Basic Vector Information
- Vector Name:
- pC1300-EGFP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10779 bp
- Type:
- Plant transformation vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Dutt M, Grosser JW.
- Promoter:
- minimal CaMV 35S
pC1300-EGFP vector Map
pC1300-EGFP vector Sequence
LOCUS 40924_7886 10779 bp DNA circular SYN 17-DEC-2018 DEFINITION Plant transformation vector pC1300-EGFP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10779) AUTHORS Dutt M, Grosser JW. TITLE An embryogenic suspension cell culture system for Agrobacterium-mediated transformation of citrus JOURNAL Plant Cell Rep. 29 (11), 1251-1260 (2010) PUBMED 20711728 REFERENCE 2 (bases 1 to 10779) AUTHORS Dutt M, Grosser JW. TITLE Direct Submission JOURNAL Submitted (04-OCT-2011) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA REFERENCE 3 (bases 1 to 10779) TITLE Direct Submission REFERENCE 4 (bases 1 to 10779) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Cell Rep."; date: "2010"; volume: "29"; issue: "11"; pages: "1251-1260" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-OCT-2011) Citrus Research and Education Center, University of Florida, 700 Experiment Station Road, Lake Alfred, FL 33850, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10779 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(10..184) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(225..941) /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature complement(977..1032) /label=TMV Omega /note="translational enhancer from the tobacco mosaic virus 5'-leader sequence (Gallie et al., 1988)" promoter complement(1044..1090) /label=minimal CaMV 35S promoter /note="minimal 35S promoter from cauliflower mosaic virus" primer_bind complement(1881..1897) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature 2100..2124 /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 3424..4050 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 4487..5551 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" rep_origin 5620..5814 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" misc_feature 6158..6298 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(6484..7072) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7162..7953) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" misc_feature 8378..8402 /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" polyA_signal complement(8480..8654) /label=CaMV poly(A) signal /note="cauliflower mosaic virus polyadenylation signal" CDS complement(8697..9719) /codon_start=1 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK K" promoter complement(9787..10464) /label=CaMV 35S promoter (enhanced) /note="cauliflower mosaic virus 35S promoter with a duplicated enhancer region" protein_bind 10655..10676 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 10691..10721 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 10729..10745 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 10753..10769 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.