pc-Cdk1-3Myc-BSR vector (V008978)

LOCUS       V008978                 4663 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008978
VERSION     V008978
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 4663)
  AUTHORS   Gourguechon S, Cande WZ.
  TITLE     Rapid tagging and integration of genes in Giardia intestinalis
  JOURNAL   Eukaryotic Cell (2010) In press
   PUBMED   21115739
REFERENCE   2  (bases 1 to 4663)
  AUTHORS   Gourguechon S, Cande WZ.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2010) Mol and Cell Biology, University of
            California, Berkeley, 345 LSA, Berkeley, CA 94720-3200, USA
REFERENCE   3  (bases 1 to 4663)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4663)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Eukaryotic
            Cell (2010) In press"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (08-NOV-2010) Mol and Cell Biology, University of California,
            Berkeley, 345 LSA, Berkeley, CA 94720-3200, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4663
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     promoter        626..644
                     /label="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             653..1498
                     /codon_start=1
                     /product="tagged cyclin-dependent kinase 1"
                     /label="tagged cyclin-dependent kinase 1"
                     /note="Cdk1"
                     /protein_id="ADR65092.1"
                     /translation="ELMSVIHHNHRLHLIFEYAENDLKKYMDKNPDVSMRVIKSFLYQL
                     INGVNFCHSRRCLHRDLKPQNLLLSVSDASETPVLKIGDFGLARAFGIPIRQFTHEIIT
                     LWYRPPEILLGSRHYSTSVDIWSIACIWAEMLMKTPLFPGDSEIDQLFKIFEVLGLPDD
                     TTWPGVTALPDWKQSFPKFRGKTLKRVLGALLDDEGLDLLTAMLEMDPVKRISAKNALE
                     HPYFSHNDFDPPGVELKRSEEQKLISEEDLLRSEEQKLISEEDLLRSEEQKLISEEDLL
                     "
     misc_feature    1373..1498
                     /label="3Myc epitope tag"
                     /note="3Myc epitope tag"
     CDS             1379..1408
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label="Myc"
                     /translation="EQKLISEEDL"
     CDS             1421..1450
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label="Myc"
                     /translation="EQKLISEEDL"
     CDS             1463..1492
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label="Myc"
                     /translation="EQKLISEEDL"
     CDS             1908..2327
                     /gene="bsr"
                     /label="Blasticidin-S deaminase"
                     /note="Blasticidin-S deaminase from Bacillus cereus.
                     Accession#: P33967"
     promoter        complement(2475..2493)
                     /label="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(2514..2530)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     protein_bind    complement(2538..2554)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2562..2592)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(2607..2628)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(2916..3504)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(3678..4535)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(4536..4640)
                     /label="AmpR promoter"