Basic Vector Information
- Vector Name:
- pC-(loxP2-attB2-SA(0))
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8600 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Diao F, Ironfield H, Luan H, Diao F, Shropshire WC, Ewer J, Marr E, Potter CJ, Landgraf M, White BH.
- Promoter:
- T3
pC-(loxP2-attB2-SA(0)) vector Map
pC-(loxP2-attB2-SA(0)) vector Sequence
LOCUS 40924_7721 8600 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pC-(loxP2-attB2-SA(0)), complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8600) AUTHORS Diao F, Ironfield H, Luan H, Diao F, Shropshire WC, Ewer J, Marr E, Potter CJ, Landgraf M, White BH. TITLE Plug-and-Play Genetic Access to Drosophila Cell Types using Exchangeable Exon Cassettes JOURNAL Cell Rep 10 (8), 1410-1421 (2015) PUBMED 25732830 REFERENCE 2 (bases 1 to 8600) AUTHORS Diao F, Luan H, White BH. TITLE Direct Submission JOURNAL Submitted (22-JAN-2015) Laboratory of Molecular Biology, NIMH, NIH, 35 Convent Dr, Bethesda, MD 20850, USA REFERENCE 3 (bases 1 to 8600) TITLE Direct Submission REFERENCE 4 (bases 1 to 8600) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell Rep"; date: "2015"; volume: "10"; issue: "8"; pages: "1410-1421" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2015) Laboratory of Molecular Biology, NIMH, NIH, 35 Convent Dr, Bethesda, MD 20850, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI v. Version 11 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..8600 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 15..242 /label=Carl_P5' P-element /note="Carl_P5' P-element" rep_origin complement(235..823) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(997..1854) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(1855..1959) /label=AmpR promoter misc_feature complement(2761..2993) /label=P element 3' end /note="P element 3' end" promoter 3017..3035 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" protein_bind 3069..3102 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind 3218..3287 /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" misc_feature 3315..3414 /label=MHC splice acceptor site /note="MHC splice acceptor site" protein_bind complement(3635..3704) /label=attB /note="attB site for the phi-C31 integrase (Groth et al., 2000)" misc_recomb 3820..3853 /label=loxP /note="loxP" protein_bind complement(3820..3853) /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." gene 3876..8004 /label=mini-white /note="This modified version of the white gene lacks part of the first intron." misc_feature complement(8015..8600) /label=P element 5' end
This page is informational only.