Basic Vector Information
- Vector Name:
- pC-(lox2-attB2-SA-Hsp70)3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11728 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Diao F, Ironfield H, Luan H, Diao F, Shropshire WC, Ewer J, Marr E, Potter CJ, Landgraf M, White BH.
- Promoter:
- T3
pC-(lox2-attB2-SA-Hsp70)3 vector Map
pC-(lox2-attB2-SA-Hsp70)3 vector Sequence
LOCUS 40924_7716 11728 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pC-(lox2-attB2-SA-Hsp70)3, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 11728)
AUTHORS Diao F, Ironfield H, Luan H, Diao F, Shropshire WC, Ewer J, Marr E,
Potter CJ, Landgraf M, White BH.
TITLE Plug-and-Play Genetic Access to Drosophila Cell Types using
Exchangeable Exon Cassettes
JOURNAL Cell Rep 10 (8), 1410-1421 (2015)
PUBMED 25732830
REFERENCE 2 (bases 1 to 11728)
AUTHORS Diao F, Luan H, White BH.
TITLE Direct Submission
JOURNAL Submitted (22-JAN-2015) Laboratory of Molecular Biology, NIMH, NIH,
35 Convent Dr, Bethesda, MD 20850, USA
REFERENCE 3 (bases 1 to 11728)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 11728)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell Rep";
date: "2015"; volume: "10"; issue: "8"; pages: "1410-1421"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(22-JAN-2015) Laboratory of Molecular Biology, NIMH, NIH, 35 Convent
Dr, Bethesda, MD 20850, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: Vector NTI v. Version 11
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..11728
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 15..242
/label=Carl_P5' P-element
/note="Carl_P5' P-element"
rep_origin complement(235..823)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(997..1854)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(1855..1959)
/label=AmpR promoter
misc_feature complement(2761..2993)
/label=P element 3' end
/note="P element 3' end"
promoter 3017..3035
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
protein_bind 3069..3102
/label=lox2272
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (AAGTATCC) (Shaw et al., 2021). lox2272 sites are
compatible with each other, but incompatible with loxP or
loxN sites (Lee and Saito, 1988)."
misc_feature 3103..3202
/label=spacer sequence between lox2272 and attB
/note="spacer sequence between lox2272 and attB"
protein_bind 3218..3287
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 3315..3414
/label=MHC splice acceptor site
/note="MHC splice acceptor site"
misc_feature 3448..3467
/label=multiple cloning site
/note="multiple cloning site"
misc_feature 3468..3958
/label=Hsp70 ployA
/note="Hsp70 ployA"
misc_recomb complement(4125..4224)
/label=attB
/note="attB"
protein_bind 4140..4209
/label=attB
/bound_moiety="phage phi-C31 integrase"
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 4225..4324
/label=spacer sequence between lox2272 and attB
/note="spacer sequence between lox2272 and attB"
misc_recomb 4325..4358
/label=lox2272
/note="lox2272"
protein_bind complement(4325..4358)
/label=lox2272
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GGATACTT). lox2272 sites are compatible with each
other, but incompatible with loxP or loxN sites."
misc_feature 4359..4378
/label=spacer sequence between between lox2272 and loxN
/note="spacer sequence between between lox2272 and loxN"
protein_bind 4379..4412
/label=loxN
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (AGGTATAC) (Shaw et al., 2021). loxN sites are
compatible with each other, but incompatible with loxP or
lox2272 sites."
misc_feature 4413..4512
/label=spacer sequence between loxN and attB
/note="spacer sequence between loxN and attB"
misc_recomb 4513..4612
/label=attB
/note="attB"
protein_bind 4528..4597
/label=attB
/bound_moiety="phage phi-C31 integrase"
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 4625..4724
/label=MHC splice acceptor site
/note="MHC splice acceptor site"
misc_feature 4760..4779
/label=multiple cloning site
/note="multiple cloning site"
misc_feature 4780..5270
/label=Hsp70 polyA
/note="Hsp70 polyA"
misc_recomb complement(5435..5534)
/label=attB
/note="attB"
protein_bind 5450..5519
/label=attB
/bound_moiety="phage phi-C31 integrase"
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 5535..5634
/label=spacer sequence between attB and loxN
/note="spacer sequence between attB and loxN"
misc_recomb 5635..5668
/label=loxN
/note="loxN"
protein_bind complement(5635..5668)
/label=loxN
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GTATACCT). loxN sites are compatible with each
other, but incompatible with loxP or lox2272 sites."
misc_feature 5669..5688
/label=spacer sequence between loxN and loxP
/note="spacer sequence between loxN and loxP"
protein_bind 5689..5722
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
misc_feature 5723..5822
/label=spacer sequence between loxP and attB
/note="spacer sequence between loxP and attB"
misc_recomb 5823..5922
/label=attB
/note="attB"
protein_bind 5838..5907
/label=attB
/bound_moiety="phage phi-C31 integrase"
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 5935..6034
/label=MHC splice acceptor site
/note="MHC splice acceptor site"
misc_feature 6069..6088
/label=MCS
/note="MCS"
misc_feature 6089..6579
/label=Hsp70 ployA
/note="Hsp70 ployA"
protein_bind complement(6760..6829)
/label=attB
/note="attB site for the phi-C31 integrase (Groth et al.,
2000)"
misc_feature 6845..6944
/label=spacer sequence between attB and loxP
/note="spacer sequence between attB and loxP"
misc_feature 6945..6978
/label=loxP
/note="loxP"
protein_bind complement(6945..6978)
/label=loxP
/bound_moiety="Cre recombinase"
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (GCATACAT)."
misc_feature 7001..11127
/label=white gene marker
/note="white gene marker"
CDS join(7483..7554,7949..8222,8297..8951,9013..9328,9549..9680,
9751..10365)
/codon_start=1
/gene="white"
/product="Drosophila white gene eye color pigment"
/label=mini-white
/note="This is a modified version of the white gene lacking
part of the first intron."
/translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
misc_feature complement(11143..11728)
/label=P element 5' end
This page is informational only.