pB[Lchsp24-pdgf-b] vector (V008983)

Download GeneBank File(.gb)

LOCUS       40924_7711       10564 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pB[Lchsp24-pdgf-b], complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10564)
  AUTHORS   Linger RJ, Belikoff EJ, Yan Y, Li F, Wantuch HA, Fitzsimons HL, 
            Scott MJ.
  TITLE     Towards next generation maggot debridement therapy: transgenic 
            Lucilia sericata larvae that produce and secrete a human growth 
            factor
  JOURNAL   BMC Biotechnol. 16 (1), 30 (2016)
  PUBMED    27006073
REFERENCE   2  (bases 1 to 10564)
  AUTHORS   Linger RJ, Belikoff EJ, Yan Y, Li F, Wantuch HA, Fitzsimons HL, 
            Scott MJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-OCT-2015) Entomology, North Carolina State University,
            112 Derieux Place, Raleigh, NC 27695-7614, USA
REFERENCE   3  (bases 1 to 10564)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10564)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "BMC 
            Biotechnol."; date: "2016"; volume: "16"; issue: "1"; pages: "30"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (10-OCT-2015) Entomology, North Carolina State University, 112 
            Derieux Place, Raleigh, NC 27695-7614, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..10564
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     379..395
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     mobile_element  1084..1858
                     /mobile_element_type="transposon:pBAC"
                     /label=BAC
     regulatory      1878..3036
                     /label=Lchsp24
                     /note="Lchsp24"
                     /regulatory_class="promoter"
     5'UTR           2895..3074
     CDS             3075..3464
                     /codon_start=1
                     /product="prePDGF-B"
                     /label=prePDGF-B
                     /protein_id="AMQ78449.1"
                     /translation="MKSFLLVLFAFLAVFAFVQASLGSLTIAEPAMIAECKTRTEVFEI
                     SRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIF
                     KKATVTLEDHLACKCETVAAARPVT"
     regulatory      3513..4048
                     /regulatory_class="polyA_signal_sequence"
     misc_feature    3513..4048
                     /label=Lchsp70
                     /note="Lchsp70"
     regulatory      4055..6263
                     /label=Lchsp83
                     /note="Lchsp83"
                     /regulatory_class="promoter"
     CDS             6264..6956
                     /label=ZsGreen
                     /note="Zoanthus green fluorescent protein (Matz et al.,
                     1999)"
     regulatory      6966..7432
                     /label=Lctub pA
                     /note="Lctub pA"
                     /regulatory_class="polyA_signal_sequence"
     mobile_element  7483..8160
                     /mobile_element_type="transposon:pBAC"
                     /label=BAC
     primer_bind     complement(8343..8359)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    8367..8383
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(8391..8421)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(8436..8457)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(8745..9333)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9507..10364)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(10365..10469)
                     /label=AmpR promoter