Basic Vector Information
- Vector Name:
- pBT
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3210 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Grafsky AJ III.
- Growth Strain(s):
- JM109
- Growth Temperature:
- 37℃
pBT vector Map
pBT vector Sequence
LOCUS 40924_7491 3210 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBT, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3210) AUTHORS Grafsky AJ III. TITLE Direct Submission JOURNAL Submitted (15-MAR-2001) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA REFERENCE 2 (bases 1 to 3210) TITLE Direct Submission REFERENCE 3 (bases 1 to 3210) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (15-MAR-2001) Technical Services, Stratagene, 11011 N. Torrey Pines Rd., La Jolla, CA 92037, USA" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3210 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(220..322) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(848..1393) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." promoter 1556..1586 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" protein_bind 1594..1610 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 1631..2341 /codon_start=1 /label=lambda repressor /note="phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG" CDS complement(join(2773..3210,1..219)) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.