Basic Vector Information
- Vector Name:
- pBSV2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6409 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Stewart PE, Thalken R, Bono JL, Rosa P.
pBSV2 vector Vector Map
pBSV2 vector Sequence
LOCUS 40924_7471 6409 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pBSV2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6409) AUTHORS Stewart PE, Thalken R, Bono JL, Rosa P. TITLE Isolation of a circular plasmid region sufficient for autonomous replication and transformation of infectious Borrelia burgdorferi JOURNAL Mol. Microbiol. 39 (3), 714-721 (2001) PUBMED 11169111 REFERENCE 2 (bases 1 to 6409) AUTHORS Stewart PE. TITLE Direct Submission JOURNAL Submitted (26-NOV-2002) LHBP, RML, 903 South 4th Street, Hamilton, MT 59840, USA REFERENCE 3 (bases 1 to 6409) TITLE Direct Submission REFERENCE 4 (bases 1 to 6409) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Microbiol."; date: "2001"; volume: "39"; issue: "3"; pages: "714-721" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-NOV-2002) LHBP, RML, 903 South 4th Street, Hamilton, MT 59840, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6409 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 71..659 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" repeat_region 790..973 /label=IR2 /note="IR2" CDS complement(1178..1738) /codon_start=1 /product="Orf3" /label=Orf3 /protein_id="AAO32125.1" /translation="MEKKRVVKVLTKKIDTYVEQNLMINESKISYYKTLKEKLNDNFKK EIFHRVENIKILKEIKDNQYYKFDGYKTFLDFIKDFDVAKTQAYKYLRLATALQEGLIK EDYLIENGIKNSYNFIKDKESPALKKSRQNPIKPLRFQLKTQESYDFYKKKSKFTSFMM HEIFENQKDFLKKLLKKYEELKI" CDS complement(1790..2341) /codon_start=1 /product="Orf2" /label=Orf2 /protein_id="AAO32124.1" /translation="MKIGLKAARINEQKIKFPKESIFLLKEKKGDKNIYHTKILKALHR VVSNKQKRCIIFFEKLLDKSEIQKLYLYPMKDGDKFLGIYYGYRKPINNVFVKYEINGV ENVYTFSKIYYIEFRFKTGSVCCYLKNMRRLLRKEKIDTPYNKAIVDKFIDLEKHVYEF YNKKYSSEGLILKWILKNLK" CDS complement(2351..3478) /codon_start=1 /product="Orf1" /label=Orf1 /protein_id="AAO32123.1" /translation="MENLSNINKTSKTTTCYNKLQYKLVVLISTLAYINKTYKKYTQKN ILYYFNENLKRNSQTPVKLKTLQNYLYKLEKEFKVTTNYHKHLGVNLGTEIYYQLNFSK KECYQKIYKYFQEKKDLRFQNRVSRGLKDRFTKNGSVDLKECLNNKNNIKEERKINEIE KYQVRNYFNKCNFLCKKILSIFLTILFNLNIDKDNIIKILKIIKIIEIKLLKNKNIHFT KSCMKEKQEKLKEILCNTQKEFEKNEYNSKQLETSFQKIYENYKFKPHFIIESHKYSDL NNIKRKLEKSIERKKENSQQNYQDLKTNIFNILIEQLKKEVNIELLKPIIKEYLNNQKK IEYNKVFCTYYCELLELMKNQKSLLSLKELNRKAI" repeat_region 3709..3892 /label=IR1 /note="IR1" protein_bind 4142..4163 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 4178..4208 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 4216..4232 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 4240..4256 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 4266..4322 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(4326..4342) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" regulatory 4492..4898 /label=FlgB promoter /note="FlgB promoter" /regulatory_class="promoter" CDS 4899..5705 /label=KanR /note="aminoglycoside phosphotransferase" CDS 5968..6339 /label=BleoR /note="antibiotic-binding protein"
This page is informational only.