pBSTG1 vector (V009024)

Download GeneBank File(.gb)

LOCUS       40924_7466        3795 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBSTG1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3795)
  AUTHORS   Tiede C, Tang AA, Deacon SE, Mandal U, Nettleship JE, Owen RL, 
            George SE, Harrison DJ, Owens RJ, Tomlinson DC, McPherson MJ.
  TITLE     Adhiron: a stable and versatile peptide display scaffold for 
            molecular recognition applications
  JOURNAL   Protein Eng. Des. Sel. 27 (5), 145-155 (2014)
  PUBMED    24668773
REFERENCE   2  (bases 1 to 3795)
  AUTHORS   Deacon SE, Tiede C, Tomlinson DC, McPherson MJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-2014) School of Molecular and Cellular Biology, 
            University of Leeds, Astbury Building, Leeds, West Yorkshire WF12 
            0LN, UK
REFERENCE   3  (bases 1 to 3795)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3795)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Protein 
            Eng. Des. Sel."; date: "2014"; volume: "27"; issue: "5"; pages: 
            "145-155"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-FEB-2014) School of Molecular and Cellular Biology, University 
            of Leeds, Astbury Building, Leeds, West Yorkshire WF12 0LN, UK"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3795
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        1..31
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    39..55
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     63..79
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    131..187
                     /label=DsbA secretion signal sequence
                     /note="DsbA secretion signal sequence"
     CDS             236..253
                     /label=6xHis
                     /note="6xHis affinity tag"
     misc_feature    257..301
                     /note="flexible linker between oligohistidine tag and
                     truncated M13 gp3 coding region"
     CDS             302..772
                     /codon_start=1
                     /product="truncated gp3"
                     /label=truncated gp3
                     /note="minor coat protein"
                     /protein_id="AIE57570.1"
                     /translation="GGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDY
                     GAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVEC
                     RPYVFGAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES"
     primer_bind     complement(782..798)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      1011..1466
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        1748..1852
                     /label=AmpR promoter
     CDS             1853..2710
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      2884..3472
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    3760..3781
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."