Basic Vector Information
- Vector Name:
- pBSd141R
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4682 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Radeck J, Meyer D, Lautenschlager N, Mascher T.
pBSd141R vector Map
pBSd141R vector Sequence
LOCUS 40924_7396 4682 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBSd141R, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4682) AUTHORS Radeck J, Meyer D, Lautenschlager N, Mascher T. TITLE Bacillus SEVA siblings: A Golden Gate-based toolbox to create personalized integrative vectors for Bacillus subtilis JOURNAL Sci Rep 7 (1), 14134 (2017) PUBMED 29074996 REFERENCE 2 (bases 1 to 4682) AUTHORS Radeck J. TITLE Direct Submission JOURNAL Submitted (26-APR-2017) Biology, Technische Universitat Dresden, Zellescher Weg 20b, Dresden 01627, Germany REFERENCE 3 (bases 1 to 4682) TITLE Direct Submission REFERENCE 4 (bases 1 to 4682) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep"; date: "2017"; volume: "7"; issue: "1"; pages: "14134" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-APR-2017) Biology, Technische Universitat Dresden, Zellescher Weg 20b, Dresden 01627, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4682 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 217..891 /codon_start=1 /label=mRFP1 /note="monomeric derivative of DsRed (Campbell et al., 2002)" /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS TGA" terminator 1050..1144 /label=lambda t0 terminator /note="transcription terminator from phage lambda" promoter 1270..1361 /label=AmpR promoter CDS 1362..2219 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" terminator 2226..2265 /label=fd terminator /note="central terminator from bacteriophage fd (Otsuka and Kunisawa, 1982)" oriT 2412..2520 /label=oriT /note="incP origin of transfer" rep_origin 2614..3202 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3259..4089) /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" rep_origin 4103..4454 /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" terminator complement(4590..4676) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.