Basic Vector Information
- Vector Name:
- pBSD-GFP-INT-attP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8184 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nkrumah LJ, Muhle RA, Moura PA, Ghosh P, Hatfull GF, Jacobs WR Jr., Fidock DA.
pBSD-GFP-INT-attP vector Vector Map
pBSD-GFP-INT-attP vector Sequence
LOCUS 40924_7391 8184 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBSD-GFP-INT-attP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8184) AUTHORS Nkrumah LJ, Muhle RA, Moura PA, Ghosh P, Hatfull GF, Jacobs WR Jr., Fidock DA. TITLE Efficient site-specific integration in Plasmodium falciparum chromosomes mediated by mycobacteriophage Bxb1 integrase JOURNAL Nat. Methods 3 (8), 615-621 (2006) PUBMED 16862136 REFERENCE 2 (bases 1 to 8184) AUTHORS Nkrumah LJ, Moura PA, Fidock DA. TITLE Direct Submission JOURNAL Submitted (25-JUN-2006) Microbiology and Immunology, Albert Einstein College of Medicine, 1300 Morris Park, Bronx, NY 10461, USA REFERENCE 3 (bases 1 to 8184) TITLE Direct Submission REFERENCE 4 (bases 1 to 8184) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Methods"; date: "2006"; volume: "3"; issue: "8"; pages: "615-621" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-JUN-2006) Microbiology and Immunology, Albert Einstein College of Medicine, 1300 Morris Park, Bronx, NY 10461, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8184 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory complement(37..865) /label=derived from hsp86 3' UTR /note="derived from hsp86 3' UTR" /regulatory_class="terminator" CDS complement(875..1585) /label=yeGFP /note="yeast-enhanced green fluorescent protein" CDS complement(1592..1615) /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" misc_feature complement(1622..2020) /gene="bsd-FLAG-gfp" /label=BSD /note="BSD" CDS complement(1622..2020) /codon_start=1 /gene="Aspergillus terreus BSD" /product="blasticidin S deaminase" /label=BSD /note="confers resistance to blasticidin" /translation="MHAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFT GVNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPG IKAIVKDSDGQPTAVGIRELLPSGYVWEG" misc_feature complement(2036..2659) /label=contains promoter and 5' UTR from calmodulin gene /note="contains promoter and 5' UTR from calmodulin gene" misc_feature 2666..3264 /label=contains promoter and 5' UTR from PcDT gene /note="contains promoter and 5' UTR from PcDT gene" CDS 4799..4828 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" regulatory 4838..5428 /label=derived from hrp2 3' UTR /note="derived from hrp2 3' UTR" /regulatory_class="terminator" misc_recomb 5447..5496 /label=attP /note="attP" promoter complement(5502..5519) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(5526..5542) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 6016..6120 /label=AmpR promoter CDS 6121..6978 /label=AmpR /note="beta-lactamase" rep_origin 7152..7740 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 8028..8049 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 8064..8094 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 8102..8118 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 8126..8142 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 8160..8178 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.