pBSc293 vector (V009043)

Download GeneBank File(.gb)

LOCUS       40924_7366        3542 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBSc293, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3542)
  AUTHORS   Radeck J, Meyer D, Lautenschlager N, Mascher T.
  TITLE     Bacillus SEVA siblings: A Golden Gate-based toolbox to create 
            personalized integrative vectors for Bacillus subtilis
  JOURNAL   Sci Rep 7 (1), 14134 (2017)
  PUBMED    29074996
REFERENCE   2  (bases 1 to 3542)
  AUTHORS   Radeck J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2017) Biology, Technische Universitat Dresden, 
            Zellescher Weg 20b, Dresden 01627, Germany
REFERENCE   3  (bases 1 to 3542)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3542)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep"; 
            date: "2017"; volume: "7"; issue: "1"; pages: "14134"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (26-APR-2017) Biology, Technische Universitat Dresden, Zellescher 
            Weg 20b, Dresden 01627, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..3542
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    125..146
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        161..191
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    199..215
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     223..239
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    249..305
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(309..325)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     terminator      604..698
                     /label=lambda t0 terminator
                     /note="transcription terminator from phage lambda"
     CDS             877..1689
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     oriT            1859..1967
                     /label=oriT
                     /note="incP origin of transfer"
     rep_origin      2002..2590
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(2776..2916)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(3021..3209)
                     /codon_start=1
                     /label=rop
                     /note="Rop protein, which maintains plasmids at low copy
                     number"
                     /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     terminator      complement(3450..3536)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"