Basic Vector Information
- Vector Name:
- pBSc243B
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4799 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Radeck J, Meyer D, Lautenschlager N, Mascher T.
pBSc243B vector Map
pBSc243B vector Sequence
LOCUS 40924_7326 4799 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBSc243B, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4799) AUTHORS Radeck J, Meyer D, Lautenschlager N, Mascher T. TITLE Bacillus SEVA siblings: A Golden Gate-based toolbox to create personalized integrative vectors for Bacillus subtilis JOURNAL Sci Rep 7 (1), 14134 (2017) PUBMED 29074996 REFERENCE 2 (bases 1 to 4799) AUTHORS Radeck J. TITLE Direct Submission JOURNAL Submitted (26-APR-2017) Biology, Technische Universitat Dresden, Zellescher Weg 20b, Dresden 01627, Germany REFERENCE 3 (bases 1 to 4799) TITLE Direct Submission REFERENCE 4 (bases 1 to 4799) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Sci Rep"; date: "2017"; volume: "7"; issue: "1"; pages: "14134" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (26-APR-2017) Biology, Technische Universitat Dresden, Zellescher Weg 20b, Dresden 01627, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..4799 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 125..146 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 161..191 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 199..215 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 223..239 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 249..305 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(309..325) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 604..698 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS 877..1689 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" oriT 1859..1967 /label=oriT /note="incP origin of transfer" rep_origin 2061..2649 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2706..3536) /codon_start=1 /label=pRO1600 Rep /note="replication protein for the broad-host-range plasmid pRO1600 from Pseudomonas aeruginosa" /translation="VASPPMVYKSNALVEAAYRLSVQEQRIVLACISQVKRSEPVTDEV MYSVTAEDIATMAGVPIESSYNQLKEAALRLKRREVRLTQEPNGKGKRPSVMITGWVQT IIYREGEGRVELRFTKDMLPYLTELTKQFTKYALADVAKMDSTHAIRLYELLMQWDSIG QREIEIDQLRKWFQLEGRYPSIKDFKLRVLDPAVTQINEHSPLQVEWAQRKTGRKVTHL LFSFGPKKPAKAVGKAPAKRKAGKISDAEIAKQARPGETWEAARARLTQMPLDLA" rep_origin 3550..3901 /label=pRO1600 oriV /note="broad-host-range origin of replication from Pseudomonas aeruginosa plasmid pRO1600; requires the pRO1600 Rep protein for replication (West et al., 1994)" CDS complement(4060..4464) /codon_start=1 /gene="bleO" /product="BleO" /label=bleO /protein_id="ATU32889.1" /translation="MRMLQSIPALPVGDIKKSIGFYCDKLGFTLVHHEDGFAVLMCNEV RIHLWEASDEGWRSRSNDSPVCTGAESFIAGTASCRIEVEGIDELYQHIKPLGILHPNT SLKDQWWDERDFAVIDPDNNLISFFQQIKS" gene complement(4060..4464) /gene="bleO" /label=bleO terminator complement(4707..4793) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.