Basic Vector Information
- Vector Name:
- pBS50
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6658 bp
- Type:
- Yeast integrative vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A.
- Promoter:
- TEF1
pBS50 vector Map
pBS50 vector Sequence
LOCUS 40924_7276 6658 bp DNA circular SYN 17-DEC-2018 DEFINITION Yeast integrative vector pBS50, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6658) AUTHORS Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A. TITLE Protein complex structures from Bayesian modeling of in vivo FRET data JOURNAL Unpublished REFERENCE 2 (bases 1 to 6658) AUTHORS Bonomi M, Muller EGD., Pellarin R, Kim SJ, Russel D, Ramsden R, Sundin BA, Davis TN, Sali A. TITLE Direct Submission JOURNAL Submitted (31-MAY-2013) Biochemistry, University of Washington, 1705 NE Pacific St, Seattle, WA 98195-7350, USA REFERENCE 3 (bases 1 to 6658) TITLE Direct Submission REFERENCE 4 (bases 1 to 6658) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAY-2013) Biochemistry, University of Washington, 1705 NE Pacific St, Seattle, WA 98195-7350, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Main Workbench v. 6 Sequencing Technology :: Sanger dideoxy sequencing; Genbank ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6658 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 11..398 /label=TEF1 promoter /note="promoter for EF-1-alpha" CDS 434..454 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 464..484 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 488..508 /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" CDS 518..1234 /codon_start=1 /label=EYFP /note="enhanced YFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTFGYGLKCFARYPDHMKRHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLL EFVTAAGITHGMDELYK" primer_bind complement(2124..2140) /label=KS primer /note="common sequencing primer, one of multiple similar variants" terminator 2189..2378 /label=CYC1 terminator /note="transcription terminator for CYC1" promoter complement(2401..2419) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(2440..2456) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2464..2480) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2488..2518) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2533..2554) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2842..3430) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3604..4461) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(4462..4566) /label=AmpR promoter promoter 4851..5071 /label=URA3 promoter CDS 5072..5872 /codon_start=1 /label=URA3 /note="orotidine-5'-phosphate decarboxylase, required for uracil biosynthesis" /translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN" rep_origin complement(6004..6459) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 6604..6620 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 6627..6645 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 6658 /label=TEF1 promoter /note="promoter for EF-1-alpha"
This page is informational only.