Basic Vector Information
- Vector Name:
- pBS437V
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6399 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Tooley AJ, Glazer AN.
pBS437V vector Map
pBS437V vector Sequence
LOCUS V009065 6399 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009065 VERSION V009065 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6399) AUTHORS Tooley AJ, Glazer AN. TITLE Biosynthesis of the cyanobacterial light-harvesting polypeptide phycoerythrocyanin holo-alpha subunit in a heterologous host JOURNAL J. Bacteriol. 184 (17), 4666-4671 (2002) PUBMED 12169589 REFERENCE 2 (bases 1 to 6399) AUTHORS Tooley AJ, Glazer AN. TITLE Direct Submission JOURNAL Submitted (18-MAY-2003) Molecular and Cell Biology, University of California, Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA REFERENCE 3 (bases 1 to 6399) TITLE Direct Submission REFERENCE 4 (bases 1 to 6399) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Bacteriol."; date: "2002"; volume: "184"; issue: "17"; pages: "4666-4671" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-MAY-2003) Molecular and Cell Biology, University of California, Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6399 /mol_type="other DNA" /organism="synthetic DNA construct" gene 10..195 /gene="rop" /label="rop" /note="coding region not determined; ROP'; repressor of primer protein variant; regulation of plasmid replication; helps maintain medium plasmid copy number" misc_feature 297..439 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(625..1213) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1497..2285 /codon_start=1 /gene="aadA" /product="AadA" /label="aadA" /note="confers resistance to streptomycin and to spectinomycin via inactivation of the drugs by specific adenylylation" /protein_id="AAP45701.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" gene 1497..2285 /gene="aadA" /label="aadA" CDS 2506..3585 /label="lacI" /note="lac repressor" regulatory 3820..3825 /label="trc promoter" /note="trc promoter" /regulatory_class="minus_35_signal" regulatory 3843..3849 /label="trc promoter" /note="trc promoter" /regulatory_class="minus_10_signal" misc_feature 3855..3856 /label="transcription initiation site from trc promoter" /note="transcription initiation site from trc promoter" protein_bind 3857..3873 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." regulatory 3882..3887 /gene="pecA" /regulatory_class="ribosome_binding_site" CDS 3900..3917 /label="6xHis" /note="6xHis affinity tag" CDS 3939..3959 /label="TEV site" /note="tobacco etch virus (TEV) protease recognition and cleavage site" CDS 3966..4451 /gene="pecA" /label="Phycoerythrocyanin alpha chain" /note="Phycoerythrocyanin alpha chain from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576). Accession#: P35796" gene 4487..5259 /gene="pecE" /label="pecE" regulatory 4487..4492 /gene="pecE" /regulatory_class="ribosome_binding_site" CDS 4498..5259 /codon_start=1 /gene="pecE" /product="PecE" /label="pecE" /note="catalyzes both the covalent attachment of phycocyanobilin to the phycoerythrocyanin alpha subunit and its concurrent isomerization to phycobiliviolin" /protein_id="AAP45704.1" /translation="MTAEPILSPETAIAALSGEDNQIRYYAAWWLGKHNVQAGFTALCV ALFDERYRIPSGGYPLRRQAARALGLLKNPQAVPALIAALECDEDLRLREAVICSLAAI GDKRAVTPLLNLLQSSQAQPYEALIEALATLQVWSARPQIEPFLQHYSERVQCAAARYM YLLTQESEYIERIVKNLNHDNMYLRWAAVFDLGAVAHQQAVQAILTAQVPNSLKLLNLK RILEAMLNNNSVNHEKAALLFGAIDDLLIQL" gene 5268..5800 /gene="pecF" /label="pecF" regulatory 5268..5273 /gene="pecF" /regulatory_class="ribosome_binding_site" CDS 5279..5800 /codon_start=1 /gene="pecF" /product="PecF" /label="pecF" /note="catalyzes both the covalent attachment of phycocyanobilin to the phycoerythrocyanin alpha subunit and its concurrent isomerization to phycobiliviolin" /protein_id="AAP45705.1" /translation="MNQASLSVDAITNLIEAFHHHHPAVRSAAVDELIKLGSITVNLLI AAYDDSQDQGFQAQIIQVLAQIGDAKALKLLAEVVGTSVANHCQGNVRRIAARGLGKIA STTSNTEIINNAQEKLIWALLTPEDWGLRYAAAVSLQEIATPKAKAALQQAIAQETDPV VRSRMAIALS" terminator 6136..6222 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 6314..6341 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.