Basic Vector Information
- Vector Name:
- pBS414V
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6587 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Tooley AJ, Cai YA, Glazer AN.
pBS414V vector Map
pBS414V vector Sequence
LOCUS V009070 6587 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009070 VERSION V009070 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6587) AUTHORS Tooley AJ, Cai YA, Glazer AN. TITLE Biosynthesis of a fluorescent cyanobacterial C-phycocyanin holo-alpha subunit in a heterologous host JOURNAL Proc. Natl. Acad. Sci. U.S.A. 98 (19), 10560-10565 (2001) PUBMED 11553806 REFERENCE 2 (bases 1 to 6587) AUTHORS Tooley AJ, Cai YA, Glazer AN. TITLE Direct Submission JOURNAL Submitted (04-MAY-2003) Molecular and Cell Biology, University of California, Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA REFERENCE 3 (bases 1 to 6587) TITLE Direct Submission REFERENCE 4 (bases 1 to 6587) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "19"; pages: "10560-10565" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (04-MAY-2003) Molecular and Cell Biology, University of California, Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6587 /mol_type="other DNA" /organism="synthetic DNA construct" gene 10..195 /gene="rop" /label="rop" /note="coding region not determined; repressor of primer protein variant; regulation of plasmid replication; maintains medium plasmid copy number" misc_feature 297..439 /label="bom" /note="basis of mobility region from pBR322" rep_origin complement(625..1213) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1497..2285 /codon_start=1 /gene="aadA" /product="AadA" /label="aadA" /note="confers resistance to streptomycin and to spectinomycin via inactivation of the drugs by specific adenylylation" /protein_id="AAP43512.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" gene 1497..2285 /gene="aadA" /label="aadA" CDS 2506..3585 /label="lacI" /note="lac repressor" regulatory 3820..3825 /label="trc promoter" /note="trc promoter" /regulatory_class="minus_35_signal" regulatory 3843..3849 /label="trc promoter" /note="trc promoter" /regulatory_class="minus_10_signal" misc_feature 3855..3856 /note="transcription initiation site from the trc promoter" protein_bind 3857..3873 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." regulatory 3882..3887 /gene="cpcA" /regulatory_class="ribosome_binding_site" CDS 3900..3917 /label="6xHis" /note="6xHis affinity tag" CDS 3939..3959 /label="TEV site" /note="tobacco etch virus (TEV) protease recognition and cleavage site" CDS 3966..4451 /gene="cpcA" /label="C-phycocyanin alpha subunit" /note="C-phycocyanin alpha subunit from Synechocystis sp. (strain PCC 6803 / Kazusa). Accession#: Q54715" gene 4483..5313 /gene="cpcE" /label="cpcE" regulatory 4483..4488 /gene="cpcE" /regulatory_class="ribosome_binding_site" CDS 4495..5313 /codon_start=1 /gene="cpcE" /product="CpcE" /label="cpcE" /note="required for the covalent attachment of phycocyanobilin to the alpha subunit apoprotein of C-phycocyanin" /protein_id="AAP43515.1" /translation="MSEPNLNPAYTLDQAIANLQQTEDASARYYAAWWIGRFRAAQPET IAALLVALEDETDRSPDGGYPLRRNAAKALGKLGDRQVVPALIKALECEDYYVRESAAQ ALEGLGDARAMAPLMAKLTGGLAAAQLVEGKPHLAQPYEAIIEALGTLQAVESIGLIEP FLEHFSPKVQYAAARALFQLTGDNRYGDLLITALGGTDLQLRRSAMMDLGATGYLPGAQ AIAKAFAENSLKLIALRDLWATHRQRQASSESKALSPASRQILELMDSLL" gene 5330..5988 /gene="cpcF" /label="cpcF" regulatory 5330..5335 /gene="cpcF" /regulatory_class="ribosome_binding_site" CDS 5344..5988 /codon_start=1 /gene="cpcF" /product="CpcF" /label="cpcF" /note="required for the covalent attachment of phycocyanobilin to the alpha subunit apoprotein of C-phycocyanin" /protein_id="AAP43516.1" /translation="MEGNSVVTPEIERLIQAVETADSAAKLVGAVRALAATRSPLAVPQ LTTVLRYNNPGAAVAAVDGLIQIGDAAMTHLLANMDGYNYGARAWATRACAGIGDPRAL ALLQEAALTDFALSVRRAAAKGLGFLRWQSLPQEEQETVQKAIYDTLIQVCEDPEWVVR YGAIAGLENLAKQAQHYRQPLKDFLQSFVEQEPEAIVGERILWTLENIGPI" terminator 6324..6410 /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" terminator 6502..6529 /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene"
This page is informational only.