Basic Vector Information
- Vector Name:
- pBR939b
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5566 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Anderson JC, Voigt CA, Arkin AP.
pBR939b vector Map
pBR939b vector Sequence
LOCUS 40924_7026 5566 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBR939b, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5566) AUTHORS Anderson JC, Voigt CA, Arkin AP. TITLE Environmental signal integration by a modular AND gate JOURNAL Mol. Syst. Biol. 3, 133 (2007) PUBMED 17700541 REFERENCE 2 (bases 1 to 5566) AUTHORS Salis HM, Mirsky EA, Voigt CA. TITLE Automated design of synthetic ribosome binding sites to control protein expression JOURNAL Nat. Biotechnol. 27 (10), 946-950 (2009) PUBMED 19801975 REFERENCE 3 (bases 1 to 5566) AUTHORS Tamsir A, Tabor JJ, Voigt CA. TITLE Robust multicellular computing using genetically encoded NOR gates and chemical 'wires' JOURNAL Nature 469 (7329), 212-215 (2011) PUBMED 21150903 REFERENCE 4 (bases 1 to 5566) AUTHORS Moser F, Voigt CA. TITLE Genetic Circuit Performance under Conditions Relevant for Industrial Bioreactors JOURNAL Unpublished REFERENCE 5 (bases 1 to 5566) AUTHORS Anderson JC, Moser F, Tamsir A, Salis H. TITLE Direct Submission JOURNAL Submitted (06-JAN-2012) Biological Engineering, MIT, 500 Tech Square, Rm 209D, Cambridge, MA 02139, USA REFERENCE 6 (bases 1 to 5566) TITLE Direct Submission REFERENCE 7 (bases 1 to 5566) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Syst. Biol. 3, 133 (2007)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Nat. Biotechnol."; date: "2009"; volume: "27"; issue: "10"; pages: "946-950" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Nature"; date: "2011"; volume: "469"; issue: "7329"; pages: "212-215" COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 5; type: "Journal Article"; journalName: "Submitted (06-JAN-2012) Biological Engineering, MIT, 500 Tech Square, Rm 209D, Cambridge, MA 02139, USA" COMMENT SGRef: number: 6; type: "Journal Article" FEATURES Location/Qualifiers source 1..5566 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 211..229 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 296..1009 /codon_start=1 /label=GFP (S65T) /note="S65T variant of Aequorea victoria green fluorescent protein (Heim et al., 1995)" /translation="MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK FICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDG NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE FVTAAGITHGMDELYK" terminator 1074..1168 /label=lambda t0 terminator /note="transcription terminator from phage lambda" CDS 1225..1254 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 1270..1287 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1513..1559 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" promoter 1685..1789 /label=AmpR promoter CDS 1790..2647 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2820..3408 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(3594..3734) /label=bom /note="basis of mobility region from pBR322" CDS complement(3839..4027) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL"
This page is informational only.