Basic Vector Information
- Vector Name:
- pBOMBER
- Length:
- 11489 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Host:
- Plants
- Source/Author:
- Plackett AR, Conway SJ, Hewett Hazelton KD, Rabbinowitsch EH, Langdale JA, Di Stilio VS.
- Promoter:
- NOS
pBOMBER vector Vector Map
pBOMBER vector Sequence
LOCUS 40924_6996 11489 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pBOMBER, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11489) AUTHORS Plackett AR, Conway SJ, Hewett Hazelton KD, Rabbinowitsch EH, Langdale JA, Di Stilio VS. TITLE LEAFY maintains apical stem cell activity during shoot development in the fern Ceratopteris richardii JOURNAL Elife 7, e39625 (2018) PUBMED 30355440 REFERENCE 2 (bases 1 to 11489) AUTHORS Plackett ARG., Rabbinowitsch EH, Langdale JA. TITLE Direct Submission JOURNAL Submitted (05-SEP-2018) Department of Plant Sciences, University of Cambridge, Downing Street, Cambridge, Cambridgeshire CB2 3EA, United Kingdom REFERENCE 3 (bases 1 to 11489) TITLE Direct Submission REFERENCE 4 (bases 1 to 11489) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Elife 7, e39625 (2018)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (05-SEP-2018) Department of Plant Sciences, University of Cambridge, Downing Street, Cambridge, Cambridgeshire CB2 3EA, United Kingdom" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11489 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(477..501) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" protein_bind 757..778 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 793..823 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 831..847 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 855..871 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 889..907 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" promoter 1068..1247 /label=NOS promoter /note="nopaline synthase promoter" CDS 1283..2305 /codon_start=1 /product="HPT" /label=HPT /protein_id="AYO90637.1" /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ TVMDDTVSASVAQALDELMLWARTAPKSGTRARGFGSNNVLTDNGRITAVIDWSEAMFG DSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDGN FDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE " terminator 2503..2755 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature complement(3051..3075) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" oriT 3630..3739 /label=oriT /note="incP origin of transfer" mobile_element 3799..4566 /label=IS1 /note="prokaryotic transposable element" CDS 4566..4916 /codon_start=1 /label=traJ /note="oriT-recognizing protein" /translation="PTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAVGQGYKI TGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEEKQDELG KVMMGVVRPRAEP" CDS 5191..6336 /codon_start=1 /label=trfA /note="trans-acting replication protein that binds to and activates oriV" /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR" rep_origin complement(7699..8287) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 9384..10172 /codon_start=1 /product="SpecR" /label=SpecR /protein_id="AYO90638.1" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin complement(10777..11489) /direction=LEFT /label=oriV /note="incP origin of replication"
This page is informational only.