Basic Vector Information
- Vector Name:
- pBMTL-5
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 3284 bp
- Type:
- Broad host range vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Lynch MD, Gill RT.
pBMTL-5 vector Vector Map
pBMTL-5 vector Sequence
LOCUS 40924_6951 3284 bp DNA circular SYN 17-DEC-2018 DEFINITION Broad host range vector pBMTL-5, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3284) AUTHORS Lynch MD, Gill RT. TITLE Broad host range vectors for stable genomic library construction JOURNAL Biotechnol. Bioeng. 94 (1), 151-158 (2006) PUBMED 16496398 REFERENCE 2 (bases 1 to 3284) AUTHORS Lynch MD, Gill RT. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 3284) TITLE Direct Submission REFERENCE 4 (bases 1 to 3284) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng."; date: "2006"; volume: "94"; issue: "1"; pages: "151-158" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-MAY-2005) Chemical " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3284 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(60..96) /label=soxR terminator /note="bidirectional E. coli soxR transcription terminator" CDS complement(104..1123) /codon_start=1 /gene="mob" /product="Mob" /label=mob /note="required for mobilization" /protein_id="AAY99744.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS" gene complement(104..1123) /gene="mob" /label=mob /note="mob gene from pBBR1MCS, GenBank Accession Number U02374" rep_origin 1347..2116 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 2117..2776 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" CDS 2876..3109 /codon_start=1 /label=TpR /note="E. coli plasmid-associated dihydrofolate reductase" /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW YCTKLTPEGYAVESESHPGSVQIYPVAALERVA" terminator complement(3129..3160) /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" promoter 3207..3237 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3245..3261 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.