Basic Vector Information
- Vector Name:
- pBMTBX-5
- Antibiotic Resistance:
- Trimethoprim
- Length:
- 4497 bp
- Type:
- Broad host range vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Prior JE, Lynch MD, Gill RT.
- Promoter:
- araBAD
pBMTBX-5 vector Map
pBMTBX-5 vector Sequence
LOCUS 40924_6921 4497 bp DNA circular SYN 17-DEC-2018 DEFINITION Broad host range vector pBMTBX-5, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4497) AUTHORS Prior JE, Lynch MD, Gill RT. TITLE Broad host range vectors for expression in Gram negative hosts JOURNAL Unpublished REFERENCE 2 (bases 1 to 4497) AUTHORS Prior JE, Lynch MD, Gill RT. TITLE Direct Submission JOURNAL Submitted (01-AUG-2009) Chemical and Biological Engineering, University of Colorado, UCB 424, Boulder, CO 80309, USA REFERENCE 3 (bases 1 to 4497) TITLE Direct Submission REFERENCE 4 (bases 1 to 4497) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-AUG-2009) Chemical and Biological Engineering, University of Colorado, UCB 424, Boulder, CO 80309, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4497 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(60..96) /label=soxR terminator /note="bidirectional E. coli soxR transcription terminator" CDS complement(104..1123) /codon_start=1 /gene="mob" /product="Mob" /label=mob /note="required for mobilization" /protein_id="ACV83891.1" /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS" gene complement(104..1123) /gene="mob" /label=mob /note="mob gene from pBBR1MCS in INSD accession U02374" rep_origin 1347..2116 /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication" CDS 2117..2776 /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" CDS 2876..3109 /codon_start=1 /label=TpR /note="E. coli plasmid-associated dihydrofolate reductase" /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW YCTKLTPEGYAVESESHPGSVQIYPVAALERVA" terminator complement(3129..3160) /label=tonB terminator /note="bidirectional E. coli tonB-P14 transcription terminator" CDS complement(3191..4066) /codon_start=1 /label=araC /note="L-arabinose regulatory protein" /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE EKVNDVAVKLS" promoter 4093..4377 /label=araBAD promoter /note="promoter of the L-arabinose operon of E. coli; the araC regulatory gene is transcribed in the opposite direction (Guzman et al., 1995)"
This page is informational only.