Basic Vector Information
- Vector Name:
- pBlueBacmsGCB1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6926 bp
- Type:
- Insect expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pBlueBacmsGCB1 vector Vector Map
pBlueBacmsGCB1 vector Sequence
LOCUS V009148 6926 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009148 VERSION V009148 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6926) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6926) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6926) TITLE Direct Submission REFERENCE 4 (bases 1 to 6926) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6926 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 4..95 /label="polyhedrin promoter" /note="promoter for the baculovirus polyhedrin gene" CDS 194..2053 /gene="Gucy1b1" /label="Guanylate cyclase soluble subunit beta-1" /note="Guanylate cyclase soluble subunit beta-1 from Mus musculus. Accession#: O54865" CDS 2095..2136 /label="V5 tag" /note="epitope tag from simian virus 5" CDS 2146..2163 /label="6xHis" /note="6xHis affinity tag" polyA_signal 2188..2320 /label="SV40 poly(A) signal" /note="SV40 polyadenylation signal" misc_recomb 2333..3038 /label="baculovirus recombination region (ORF1629)" /note="contains part of ORF1629" promoter 3611..3715 /label="AmpR promoter" CDS 3716..4573 /label="AmpR" /note="beta-lactamase" rep_origin 4747..5335 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5512..6624) /codon_start=1 /note="unnamed protein product; 5' lacZ fragment" /protein_id="SJL87778.1" /translation="MIDPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ QLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPIT VNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRL PSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFH VATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGY ADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLL NGKPLLIRGVNRHEHHPLHGQVMDEQTMVQD" regulatory complement(6625..6899) /label="AcNPV-ETL promoter" /note="AcNPV-ETL promoter" /regulatory_class="promoter"
This page is informational only.