Basic Vector Information
- Vector Name:
- pBlueBacmsGCA1s
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6592 bp
- Type:
- Insect expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- polyhedrin
pBlueBacmsGCA1s vector Map
pBlueBacmsGCA1s vector Sequence
LOCUS 40924_6741 6592 bp DNA circular SYN 17-DEC-2018 DEFINITION Insect expression vector pBlueBacmsGCA1s, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6592) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6592) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6592) TITLE Direct Submission REFERENCE 4 (bases 1 to 6592) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6592 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 4..95 /label=polyhedrin promoter /note="promoter for the baculovirus polyhedrin gene" CDS 214..1704 /codon_start=1 /note="unnamed protein product; mGucy1a3 splice variant" /protein_id="SJL87783.1" /translation="MFCRKFKDLKITGECPFSLLAPGIIKAAARILYESHVEVSLMPPC FRSDCTEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPASLFCKTFPFHFMLDRDLAI LQLGNGIRRLVNKRDFQGKPNFEEFFEILTPKINQTFSGIMTMLNMQFVIRVRRWDNSV KKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIG EQARAQDGLKKRLGKLKATLEHAHQALEEEKKRTVDLLCSIFPSEVAQQLWQGQIVQAK KFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCV AGGLHRESDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPR YCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFTPRSREELPPNFPSDIPG ICHFLDAYHHQGPNSKPWFQDKDVEDGNANFLGKASGVD" CDS 1761..1802 /label=V5 tag /note="epitope tag from simian virus 5" CDS 1812..1829 /label=6xHis /note="6xHis affinity tag" polyA_signal 1854..1986 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" misc_recomb 1999..2704 /label=baculovirus recombination region (ORF1629) /note="contains part of ORF1629" promoter 3277..3381 /label=AmpR promoter CDS 3382..4239 /label=AmpR /note="beta-lactamase" rep_origin 4413..5001 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5178..6290) /codon_start=1 /note="unnamed protein product; lacZ fragment" /protein_id="SJL87786.1" /translation="MIDPVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQ QLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNVTYPIT VNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYGQDSRL PSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQISDFH VATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIIDERGGY ADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIENGLLLL NGKPLLIRGVNRHEHHPLHGQVMDEQTMVQD" regulatory complement(6291..6565) /label=AcNPV-ETL promoter /note="AcNPV-ETL promoter" /regulatory_class="promoter"
This page is informational only.