Basic Vector Information
- Vector Name:
- pBlTAL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8219 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Anasontzis GE, Stathopoulou PM, Hatzinikolaou DG.
- Promoter:
- trpC
pBlTAL vector Vector Map
pBlTAL vector Sequence
LOCUS 40924_6706 8219 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pBlTAL, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8219) AUTHORS Anasontzis GE, Stathopoulou PM, Hatzinikolaou DG. TITLE Homologous overexpression of transaldolase in Fusarium oxysporum JOURNAL Unpublished REFERENCE 2 (bases 1 to 8219) AUTHORS Anasontzis GE, Stathopoulou PM, Hatzinikolaou DG. TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Laboratory of Microbiology, Sector of Botany, Department of Biology, National and Kapodistrian University of Athens, Zografou Campus, Zografou, Attiki 15784, Greece REFERENCE 3 (bases 1 to 8219) TITLE Direct Submission REFERENCE 4 (bases 1 to 8219) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-MAR-2011) Laboratory of Microbiology, Sector of Botany, Department of Biology, National and Kapodistrian University of Athens, Zografou Campus, Zografou, Attiki 15784, Greece" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8219 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(3..458) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 600..616 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 626..644 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 673..1029 /label=trpC promoter /note="promoter for Aspergillus nidulans trpC" CDS 1040..2062 /label=HygR /note="aminoglycoside phosphotransferase from E. coli" terminator 2235..2793 /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene" primer_bind 3086..3102 /label=KS primer /note="common sequencing primer, one of multiple similar variants" terminator complement(3184..3740) /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene" CDS complement(join(3745..3978,4042..4425,4484..4767,4925..4936, 4996..5014,5237..5275)) /codon_start=1 /product="transaldolase" /label=transaldolase /note="from Fusarium oxysporum" /protein_id="AEP71396.1" /translation="MSSSLEQLKATGTTVVSDSGDFASIGKYKPQDATTNPSLILAASK KAEYAKLIDVAIDYAKQKGGPIDQQVDDALDRLLVEFGKEILKIIPGKVSTEVDARYSF DTEASVNKALHLIELYGEQGISKDRILIKIAATWEGIKAAEILQRDHGINTNLTLMFSL VQAIGAAEAGAYLISPFVGRILDWFKASTKKEYSKEEDPGVQSVKTIFNYYKKYGYNTI VMGASFRNTGEITELAGCDYLTISPNLLEELLNSNEPVPKKLDASQASSLDIEKKSYIN DEALFRFDFNEDQMAVEKLREGISKFAADAVTLKSILKEKLA" regulatory complement(5284..6004) /label=gpdA promoter from Aspergillus nidulans /note="gpdA promoter from Aspergillus nidulans" /regulatory_class="promoter" promoter complement(6031..6049) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(6070..6086) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(6094..6110) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(6118..6148) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(6163..6184) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(6472..7060) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7234..8091) /label=AmpR /note="beta-lactamase" promoter complement(8092..8196) /label=AmpR promoter
This page is informational only.