Basic Vector Information
- Vector Name:
- pBL132
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5033 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
pBL132 vector Vector Map
pBL132 vector Sequence
LOCUS 40924_6616 5033 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pBL132, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5033)
AUTHORS Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
TITLE Phosphatase activity tunes two-component system sensor detection
threshold
JOURNAL Nat Commun 9 (1), 1433 (2018)
PUBMED 29650958
REFERENCE 2 (bases 1 to 5033)
AUTHORS Landry BP.
TITLE Direct Submission
JOURNAL Submitted (29-OCT-2017) Bioengineering, Rice University, 6100 Main
St, Houston, TX 77005, USA
REFERENCE 3 (bases 1 to 5033)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5033)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2018"; volume: "9"; issue: "1"; pages: "1433"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-OCT-2017) Bioengineering, Rice University, 6100 Main St,
Houston, TX 77005, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5033
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..148
/label=PKanR from E. coli tn5
/note="PKanR from E. coli tn5"
/regulatory_class="promoter"
CDS 149..937
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
terminator 952..1046
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
misc_feature 1048..1049
/label=GC>CA
/note="GC>CA"
rep_origin 1160..1705
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
promoter 1878..1955
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 1956..3035
/label=lacI
/note="lac repressor"
terminator 3044..3130
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature complement(3144..3149)
/label=AvrII Scar
/note="AvrII Scar"
misc_feature complement(3149..3196)
/label=ColE1 Fragment
/note="ColE1 Fragment"
misc_feature 3258
/label=+1
/note="+1"
promoter 3302..3330
/label=tac promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
misc_feature 3336
/label=+1
/note="+1"
protein_bind 3338..3354
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
misc_feature 3364..3398
/label=sRBS 16573.91
/note="sRBS 16573.91"
CDS 3399..4853
/codon_start=1
/product="Taz"
/label=Taz
/protein_id="AWU50960.1"
/translation="MINRIRVVTLLVMVLGVFALLQLISGSLFFSSLHHSQKSFVVSNQ
LREQQGELTSTWDLMLQTRINLSRSAVRMMMDSSNQQSNAKVELLDSARKTLAQAATHY
KKFKSMAPLPEMVATSRNIDEKYKNYYTALTELIDYLDYGNTGAYFAQPTQGMQNAMGE
AFAQYALSSEKLYRDIVTDNADDYRFAQWQLAVIALVVVLILLVAWYGIRRMLLTPLAK
IIAHIREIAGGNLANTLTIDGRSEMGDLAQSVSHMAAGVKQLADDRTLLMAGVSHDLRT
PLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLG
EVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPN
RAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGT
SERGGLSIRAWLPVPVTRAQGTTKEG"
misc_feature 3399..4166
/label=Tar
/note="Tar"
misc_feature 4167..4850
/label=Cytosolic Domain
/note="Cytosolic Domain"
misc_feature 4167..4367
/label=A Domain
/note="A Domain"
misc_feature 4167..4187
/label=HAMP
/note="HAMP"
misc_feature 4182..4283
/label=alpha 1
/note="alpha 1"
misc_feature 4197..4379
/label=HisKA
/note="HisKA"
misc_feature 4227..4244
/label=H-Box
/note="H-Box"
misc_feature 4227..4229
/label=Phospho Acceptor
/note="Phospho Acceptor"
misc_feature 4248..4253
/label=SDAA
/note="SDAA"
misc_feature 4260..4265
/label=SDAA
/note="SDAA"
misc_feature 4269..4274
/label=SDAA
/note="SDAA"
misc_feature 4287..4367
/label=alpha 2
/note="alpha 2"
misc_feature 4305..4307
/label=SDAA
/note="SDAA"
misc_feature 4314..4319
/label=SDAA
/note="SDAA"
misc_feature 4368..4850
/label=B Domain
/note="B Domain"
misc_feature 4383..4403
/label=beta 1
/note="beta 1"
misc_feature 4404..4424
/label=alpha 3
/note="alpha 3"
misc_feature 4434..4469
/label=beta 2
/note="beta 2"
misc_feature 4470..4484
/label=beta 3
/note="beta 3"
misc_feature 4488..4556
/label=alpha 4
/note="alpha 4"
misc_feature 4494..4817
/label=HATPase
/note="HATPase"
misc_feature 4527..4544
/label=N-box
/note="N-box"
misc_feature 4566..4586
/label=beta 4
/note="beta 4"
misc_feature 4596..4616
/label=beta 5
/note="beta 5"
misc_feature 4605..4634
/label=D-Box
/note="D-Box"
misc_feature 4659..4670
/label=F-Box
/note="F-Box"
misc_feature complement(4686..4703)
/label=Priming Region
/note="Priming Region"
misc_feature 4701..4718
/label=G2-box
/note="G2-box"
misc_feature 4701..4715
/label=GXGXG Motif
/note="GXGXG Motif"
misc_feature 4710..4745
/label=alpha 5
/note="alpha 5"
misc_feature 4758..4781
/label=beta 6
/note="beta 6"
misc_feature 4788..4808
/label=beta 7
/note="beta 7"
terminator complement(4871..4914)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature 4940..4947
/label=BB Scar
/note="BB Scar"
terminator 4955..4982
/label=T7Te terminator
/note="phage T7 early transcription terminator"
misc_feature 4989..5033
/label=pUC19 MCS
/note="pUC19 MCS"
This page is informational only.