Basic Vector Information
- Vector Name:
- pACYC_lgtB_ApNGT
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6476 bp
- Type:
- Expression vector
- Replication origin:
- p15A ori
- Source/Author:
- Keys TG, Wetter M, Hang I, Rutschmann C, Russo S, Mally M, Steffen M, Zuppiger M, Muller F, Schneider J, Faridmoayer A, Lin CW, Aebi M.
pACYC_lgtB_ApNGT vector Map
pACYC_lgtB_ApNGT vector Sequence
LOCUS V009586 6476 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V009586 VERSION V009586 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6476) AUTHORS Keys TG, Wetter M, Hang I, Rutschmann C, Russo S, Mally M, Steffen M, Zuppiger M, Muller F, Schneider J, Faridmoayer A, Lin CW, Aebi M. TITLE A biosynthetic route for polysialylating proteins in Escherichia coli JOURNAL Metab. Eng. (2017) In press PUBMED 29101090 REFERENCE 2 (bases 1 to 6476) AUTHORS Keys TG. TITLE Direct Submission JOURNAL Submitted (21-NOV-2016) Institute of Microbiology, ETH Zurich, Vladimir-Prelog-Weg 4, Zurich, ZH 8093, Switzerland REFERENCE 3 (bases 1 to 6476) TITLE Direct Submission REFERENCE 4 (bases 1 to 6476) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng. (2017) In press" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-NOV-2016) Institute of Microbiology, ETH Zurich, Vladimir-Prelog-Weg 4, Zurich, ZH 8093, Switzerland" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6476 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 28..75 /label="T7 terminator" /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS complement(298..954) /label="CmR" /note="chloramphenicol acetyltransferase" promoter complement(955..1057) /label="cat promoter" /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(1583..2127) /direction=LEFT /label="p15A ori" /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." protein_bind complement(2318..2339) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." CDS complement(2355..3434) /label="lacI" /note="lac repressor" promoter complement(3435..3512) /label="lacI promoter" promoter 3550..3580 /label="lac UV5 promoter" /note="E. coli lac promoter with an 'up' mutation" protein_bind 3584..3608 /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." CDS 3656..4486 /codon_start=1 /product="LgtB" /label="LgtB" /protein_id="ATN32183.1" /translation="MSQNHVISLASAAERRAHIADTFGRHGIPFQFFDALMPSERLEQA MAELVPGLSAHPYLSGVEKACFMSHAVLWKQALDEGLPYITVFEDDVLLGEGAEKFLAE DAWLQERFDPDTAFIVRLETMFMHVLTSPSGVADYCGRAFPLLESEHWGTAGYIISRKA MRFFLDRFAALPPEGLHPVDLMMFSDFFDREGMPVCQLNPALCAQELHYAKFHDQNSAL GSLIEHDRLLNRKQQRRDSPANTFKHRLIRALTKISREREKRRQRREQFIVPFQ" promoter 4498..4528 /label="lac UV5 promoter" /note="E. coli lac promoter with an ""up"" mutation" regulatory 4498..4503 /regulatory_class="minus_35_signal" regulatory 4522..4528 /note="-10 seq (TATAAT; Pribnow box)" /regulatory_class="minus_10_signal" protein_bind 4532..4556 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 4534..4554 /label="lac operator" /note="lac operator" CDS 4604..6463 /note="UDP-glucose:protein N-beta-glucosyltransferase from Actinobacillus pleuropneumoniae serotype 7 (strain AP76). Accession#: B3H2N2" /label="UDP-glucose:protein N-beta-glucosyltransferase"
This page is informational only.