Basic Vector Information
- Vector Name:
- pAct26CRFB6
- Antibiotic Resistance:
- Ampicillin
- Length:
- 11474 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Levraud JP, Boudinot P, Colin I, Benmansour A, Peyrieras N, Herbomel P, Lutfalla G.
- Promoter:
- T7
pAct26CRFB6 vector Map
pAct26CRFB6 vector Sequence
LOCUS 40924_3911 11474 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pAct26CRFB6, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11474) AUTHORS Levraud JP, Boudinot P, Colin I, Benmansour A, Peyrieras N, Herbomel P, Lutfalla G. TITLE Identification of the zebrafish IFN receptor: implications for the origin of the vertebrate IFN system JOURNAL J. Immunol. 178 (7), 4385-4394 (2007) PUBMED 17371995 REFERENCE 2 (bases 1 to 11474) AUTHORS Lutfalla G. TITLE Direct Submission JOURNAL Submitted (20-SEP-2006) UMR5124, CNRS/UMII, place Eugene Bataillon, Montpellier cedex 5 34095, France REFERENCE 3 (bases 1 to 11474) TITLE Direct Submission REFERENCE 4 (bases 1 to 11474) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Immunol."; date: "2007"; volume: "178"; issue: "7"; pages: "4385-4394" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-SEP-2006) UMR5124, CNRS/UMII, place Eugene Bataillon, Montpellier cedex 5 34095, France" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11474 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(1..456) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 598..614 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 624..642 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 5827..6777 /codon_start=1 /product="zebrafish CRFB6 receptor" /label=zebrafish CRFB6 receptor /note="helical cytokine receptor; transmembrane" /protein_id="ABJ97330.1" /translation="MTYIIHLTVFMLIVNIERTCCLNPPQDLKIVKSQLLWKPPEVDGD LRYSLQYKLDSKAEDKWYNVSSHINKNVFNITDEFYGALFRVRAEKGYHISEWAISNRV NCVNVNSCAPVVNLSEKPGIVSLTLAHMDQSLEKEHGEHLEFNISSWSVNSRENPEEDV VINSKDYIFNDLESGQIYCFQVEYLLYHKPYGKASKERCVFIPETPEAKKKRVLIYGPL ITCFVLMVCGFCIFLFCKCKSNKRVQSVVKEWFQPFKLDLPDHYKEFLSSEFPVGLAPS PSIPSLQSDDFIILKENADVEENGQEAEQQKTEIL" primer_bind complement(8185..8201) /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS 8229..8903 /codon_start=1 /label=mRFP1 /note="monomeric derivative of DsRed (Campbell et al., 2002)" /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS TGA" polyA_signal 9115..9236 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter complement(9283..9301) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(9322..9338) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind 9346..9362 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(9370..9400) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(9415..9436) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(9724..10312) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(10486..11343) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAISMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(11344..11448) /label=AmpR promoter
This page is informational only.