pACpET24 vector (V009604)

Download GeneBank File(.gb)

LOCUS       40924_3846        3259 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pACpET24, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3259)
  AUTHORS   Elce JS, Hegadorn C, Gauthier S, Vince JW, Davies PL.
  TITLE     Recombinant calpain II: improved expression systems and production 
            of a C105A active-site mutant for crystallography
  JOURNAL   Protein Eng. 8 (8), 843-848 (1995)
  PUBMED    8637855
REFERENCE   2  (bases 1 to 3259)
  AUTHORS   Elce JS.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-OCT-1994) John S. Elce, Biochemistry, Queen's 
            University, Kingston, Ontario K7L 3N6, Canada
REFERENCE   3  (bases 1 to 3259)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3259)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Protein 
            Eng."; date: "1995"; volume: "8"; issue: "8"; pages: "843-848"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (25-OCT-1994) John S. Elce, Biochemistry, Queen's University, 
            Kingston, Ontario K7L 3N6, Canada"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3259
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      783..1328
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(2504..2536)
                     /codon_start=1
                     /label=T7 tag (gene 10 leader)
                     /note="leader peptide from bacteriophage T7 gene 10"
                     /translation="MASMTGGQQMG"
     RBS             complement(2543..2565)
                     /label=RBS
                     /note="efficient ribosome binding site from bacteriophage
                     T7 gene 10 (Olins and Rangwala, 1989)"
     protein_bind    complement(2580..2604)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2605..2623)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     promoter        2912..3016
                     /label=AmpR promoter
     CDS             join(3017..3259,1..615)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     misc_feature    3201..3259
                     /label=ISS
                     /note="immunostimulatory sequence from the AmpR gene;
                     contains unmethylated CpG dinucleotides in the context of 
                     5'-AACGTT-3' (Sato et al., 1996)"