Basic Vector Information
- Vector Name:
- pACpET24
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3259 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Elce JS, Hegadorn C, Gauthier S, Vince JW, Davies PL.
pACpET24 vector Vector Map
pACpET24 vector Sequence
LOCUS 40924_3846 3259 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pACpET24, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3259) AUTHORS Elce JS, Hegadorn C, Gauthier S, Vince JW, Davies PL. TITLE Recombinant calpain II: improved expression systems and production of a C105A active-site mutant for crystallography JOURNAL Protein Eng. 8 (8), 843-848 (1995) PUBMED 8637855 REFERENCE 2 (bases 1 to 3259) AUTHORS Elce JS. TITLE Direct Submission JOURNAL Submitted (25-OCT-1994) John S. Elce, Biochemistry, Queen's University, Kingston, Ontario K7L 3N6, Canada REFERENCE 3 (bases 1 to 3259) TITLE Direct Submission REFERENCE 4 (bases 1 to 3259) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Protein Eng."; date: "1995"; volume: "8"; issue: "8"; pages: "843-848" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (25-OCT-1994) John S. Elce, Biochemistry, Queen's University, Kingston, Ontario K7L 3N6, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3259 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 783..1328 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(2504..2536) /codon_start=1 /label=T7 tag (gene 10 leader) /note="leader peptide from bacteriophage T7 gene 10" /translation="MASMTGGQQMG" RBS complement(2543..2565) /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" protein_bind complement(2580..2604) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2605..2623) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" promoter 2912..3016 /label=AmpR promoter CDS join(3017..3259,1..615) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" misc_feature 3201..3259 /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)"
This page is informational only.