Basic Vector Information
- Vector Name:
- pABCa
- Antibiotic Resistance:
- Gentamycin
- Length:
- 6743 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Doehlemann J, Wagner M.
pABCa vector Vector Map
pABCa vector Sequence
LOCUS 40924_3511 6743 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pABCa, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6743) AUTHORS Doehlemann J, Wagner M. TITLE A family of single copy repABC-type shuttle vectors stably maintained in the alpha-proteobacterium Sinorhizobium meliloti JOURNAL Unpublished REFERENCE 2 (bases 1 to 6743) AUTHORS Doehlemann J, Wagner M. TITLE Direct Submission JOURNAL Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany REFERENCE 3 (bases 1 to 6743) TITLE Direct Submission REFERENCE 4 (bases 1 to 6743) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6743 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..4692 /label=oriVSm part (oriV_pMlb) /note="oriVSm part (oriV_pMlb)" terminator 4715..4742 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(4880..4907) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 5044..5130 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature 5214..5243 /label=MCS /note="MCS" rep_origin 5320..5865 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(6140..6670) /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQARS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT"
This page is informational only.