Basic Vector Information
- Vector Name:
- pABC5
- Antibiotic Resistance:
- Streptomycin
- Length:
- 7181 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Doehlemann J, Wagner M.
pABC5 vector Map
pABC5 vector Sequence
LOCUS 40924_3501 7181 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pABC5, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7181) AUTHORS Doehlemann J, Wagner M. TITLE A family of single copy repABC-type shuttle vectors stably maintained in the alpha-proteobacterium Sinorhizobium meliloti JOURNAL Unpublished REFERENCE 2 (bases 1 to 7181) AUTHORS Doehlemann J, Wagner M. TITLE Direct Submission JOURNAL Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany REFERENCE 3 (bases 1 to 7181) TITLE Direct Submission REFERENCE 4 (bases 1 to 7181) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7181 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..4870 /label=oriVSm part (oriV_p42f1) derived from pLoriV-42f1 /note="oriVSm part (oriV_p42f1) derived from pLoriV-42f1" terminator 4926..4953 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 5091..5118 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 5255..5341 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature 5425..5454 /label=MCS /note="MCS" terminator complement(5486..5513) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin 5606..6194 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6287..7075) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
This page is informational only.