Basic Vector Information
- Vector Name:
- pABC1-loxB
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9602 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Doehlemann J, Wagner M.
- Promoter:
- sacB
pABC1-loxB vector Map
pABC1-loxB vector Sequence
LOCUS 40924_3401 9602 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pABC1-loxB, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9602) AUTHORS Doehlemann J, Wagner M. TITLE A family of single copy repABC-type shuttle vectors stably maintained in the alpha-proteobacterium Sinorhizobium meliloti JOURNAL Unpublished REFERENCE 2 (bases 1 to 9602) AUTHORS Doehlemann J, Wagner M. TITLE Direct Submission JOURNAL Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany REFERENCE 3 (bases 1 to 9602) TITLE Direct Submission REFERENCE 4 (bases 1 to 9602) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse 35043, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..9602 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..4558 /label=oriVSm part (oriV_p42b) derived from pLoriV-42b /note="oriVSm part (oriV_p42b) derived from pLoriV-42b" terminator 4614..4641 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 4779..4806 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 4943..5029 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" misc_feature 5113..5142 /label=MCS /note="MCS" protein_bind complement(5143..5176) /label=lox71 /note="Left element (LE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." terminator 5208..5235 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" rep_origin 5328..5916 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" promoter 6058..6503 /label=sacB promoter /note="sacB promoter and control region" CDS 6504..7922 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVSEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" oriT complement(8279..8388) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind complement(8531..8564) /label=lox66 /note="Right element (RE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." terminator complement(8590..8617) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS complement(8708..9496) /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
This page is informational only.