Basic Vector Information
- Vector Name:
- pAB707
- Antibiotic Resistance:
- Apramycin
- Length:
- 7406 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Murakami T, Burian J, Yanai K, Bibb MJ, Thompson CJ.
pAB707 vector Vector Map
pAB707 vector Sequence
LOCUS 40924_3361 7406 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pAB707, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7406) AUTHORS Murakami T, Burian J, Yanai K, Bibb MJ, Thompson CJ. TITLE A system for the targeted amplification of bacterial gene clusters multiplies antibiotic yield in Streptomyces coelicolor JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (38), 16020-16025 (2011) PUBMED 21903924 REFERENCE 2 (bases 1 to 7406) AUTHORS Murakami T, Burian J IV, Yanai K, Bibb MJ, Thompson CJ. TITLE Direct Submission JOURNAL Submitted (20-MAY-2011) Microbiology and Immunology, University of British Columbia, 2350 Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada REFERENCE 3 (bases 1 to 7406) TITLE Direct Submission REFERENCE 4 (bases 1 to 7406) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl. Acad. Sci. U.S.A."; date: "2011"; volume: "108"; issue: "38"; pages: "16020-16025" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-MAY-2011) Microbiology and Immunology, University of British Columbia, 2350 Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7406 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(107..127) /codon_start=1 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" /translation="PKKKRKV" misc_feature 173..804 /label=derived from Streptomyces kanamyceticus /note="derived from Streptomyces kanamyceticus" misc_recomb 503..527 /label=recombination site RsA /note="recombination site RsA" protein_bind 1002..1035 /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" oriT complement(1042..1151) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS 1467..2267 /codon_start=1 /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH LAELMAKVPYGVPRHCTILHDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG" protein_bind 2277..2323 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." misc_recomb complement(2290..2323) /label=FRT site /note="FRT site" misc_feature 2343..4428 /label=derived from Streptomyces kanamyceticus /note="derived from Streptomyces kanamyceticus" misc_recomb 4039..4066 /label=recombination site RsB /note="recombination site RsB" promoter complement(4712..4730) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" promoter 4845..4949 /label=AmpR promoter CDS 4950..5807 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 5981..6569 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(6954..7088) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal"
This page is informational only.