Basic Vector Information
- Vector Name:
- p892INS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5631 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Coy DL, Wagenbach M, Hancock WO, Howard J.
p892INS vector Map
p892INS vector Sequence
LOCUS 40924_2957 5631 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector p892INS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5631) AUTHORS Coy DL, Wagenbach M, Hancock WO, Howard J. TITLE Kinesin's tail domain is an inhibitory regulator of the motor JOURNAL Unpublished REFERENCE 2 (bases 1 to 5631) AUTHORS Coy DL, Wagenbach M, Howard J. TITLE Direct Submission JOURNAL Submitted (30-DEC-1998) Department of Physiology and Biophysics, University of Washington, Campus Box 357290, Seattle, WA 98195-7290, USA REFERENCE 3 (bases 1 to 5631) TITLE Direct Submission REFERENCE 4 (bases 1 to 5631) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-DEC-1998) Department of Physiology and Biophysics, University of Washington, Campus Box 357290, Seattle, WA 98195-7290, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5631 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 12..467 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(563..1375) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1497..2085 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(2271..2413) /label=bom /note="basis of mobility region from pBR322" CDS complement(2518..2706) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(3481..3502) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(3518..4597) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4598..4675) /label=lacI promoter promoter 4988..5006 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 5007..5031 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." RBS 5046..5068 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 5079..5096 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 5106..5123 /codon_start=1 /label=thrombin site /note="thrombin recognition and cleavage site" /translation="LVPRGS" CDS 5130..5174 /codon_start=1 /label=S-Tag /note="affinity and epitope tag derived from pancreatic ribonuclease A" /translation="KETAAAKFERQHMDS" CDS 5190..5204 /codon_start=1 /label=enterokinase site /note="enterokinase recognition and cleavage site" /translation="DDDDK" CDS 5475..5492 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 5559..5606 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.