Basic Vector Information
- Vector Name:
- p713-909
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4491 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Shigaki T, Vyzasatya RR, Sivitz AB, Ward JM, Sze H, Hirschi KD.
p713-909 vector Map
p713-909 vector Sequence
LOCUS 40924_2942 4491 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector p713-909, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4491) AUTHORS Shigaki T, Vyzasatya RR, Sivitz AB, Ward JM, Sze H, Hirschi KD. TITLE The Cre-loxP recombination-based reporter system for plant transcriptional expression studies JOURNAL Plant Mol. Biol. 58 (1), 65-73 (2005) PUBMED 16028117 REFERENCE 2 (bases 1 to 4491) AUTHORS Shigaki T, Hirschi KD, Ward JM, Sze H. TITLE Direct Submission JOURNAL Submitted (03-SEP-2004) Pediatrics, Baylor College of Medicine, Room 9016, CNRC, 1100 Bates St., Houston, TX 77030, USA REFERENCE 3 (bases 1 to 4491) TITLE Direct Submission REFERENCE 4 (bases 1 to 4491) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol. Biol."; date: "2005"; volume: "58"; issue: "1"; pages: "65-73" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (03-SEP-2004) Pediatrics, Baylor College of Medicine, Room 9016, CNRC, 1100 Bates St., Houston, TX 77030, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4491 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind complement(7..40) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS 97..807 /codon_start=1 /label=GFP (S65T) /note="S65T variant of Aequorea victoria green fluorescent protein (Heim et al., 1995)" /translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF ICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF VTAAGITHGMDELYK" polyA_signal 925..1132 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" terminator 1204..1251 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin complement(1347..1735) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" rep_origin complement(1756..2211) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(2248..3105) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPFRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(3106..3210) /label=AmpR promoter
This page is informational only.