Basic Vector Information
- Vector Name:
- p5E-CAGGS
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4511 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Hall TE, Currie PD.
- Promoter:
- CAG
p5E-CAGGS vector Map
p5E-CAGGS vector Sequence
LOCUS 40924_2897 4511 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector p5E-CAGGS, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4511) AUTHORS Hall TE, Currie PD. TITLE Direct Submission JOURNAL Submitted (23-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia REFERENCE 2 (bases 1 to 4511) TITLE Direct Submission REFERENCE 3 (bases 1 to 4511) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (23-SEP-2011) Australian Regenerative Medicine Institute, Monash University, Building 75, Melbourne, VIC 3800, Australia" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..4511 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 593..688 /label=attL4 /note="recombination site for the Gateway(R) LR reaction" promoter 690..708 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" enhancer 741..1120 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 1122..1399 /label=chicken beta-actin promoter intron 1400..2417 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" primer_bind complement(2485..2501) /label=SK primer /note="common sequencing primer, one of multiple similar variants" promoter complement(2538..2556) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" protein_bind 2556..2680 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" promoter complement(2753..2771) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(2776..2792) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 2905..3711 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3861..4449 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.