Basic Vector Information
- Vector Name:
- p3E-zfRab18a
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3256 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nixon SJ, Hall TE, Parton RG.
p3E-zfRab18a vector Map
p3E-zfRab18a vector Sequence
LOCUS 40924_2657 3256 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector p3E-zfRab18a, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3256) AUTHORS Nixon SJ, Hall TE, Parton RG. TITLE Rab18 in zebrafish JOURNAL Unpublished REFERENCE 2 (bases 1 to 3256) AUTHORS Hall TE, Parton RG. TITLE Direct Submission JOURNAL Submitted (13-JUN-2014) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia REFERENCE 3 (bases 1 to 3256) TITLE Direct Submission REFERENCE 4 (bases 1 to 3256) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JUN-2014) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3256 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind complement(624..748) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 747..1364 /codon_start=1 /product="Rab18a" /label=Rab18a /note="derived from zebrafish" /protein_id="AIO08310.1" /translation="MNDDILTTLKILIIGESGVGKSSLLLRFTDDTFDAEIGATIGVDF KVKTLAVDGNRAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRRETFAKLDNWLS ELETYCTRNDLVKMLVGNKIDKDDREIEREEGLKFARKHSMLFIESSAKTRDGVQCAFE ELVEKILQTPGLWESMHKSRGVALSELSESSQGGCGAYCSLL" protein_bind complement(1365..1460) /label=attL3 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1498..1516) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1521..1537) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1650..2456 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2606..3194 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.