Basic Vector Information
- Vector Name:
- p34S-Km3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3714 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dennis JJ, Zylstra GJ.
p34S-Km3 vector Vector Map
p34S-Km3 vector Sequence
LOCUS 40924_2592 3714 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector p34S-Km3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3714) AUTHORS Dennis JJ, Zylstra GJ. TITLE Plasposons: modular self-cloning minitransposon derivatives for rapid genetic analysis of gram-negative bacterial genomes JOURNAL Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998) PUBMED 9647854 REFERENCE 2 (bases 1 to 3714) AUTHORS Dennis JJ, Zylstra GJ. TITLE Improved antibiotic-resistance cassettes through restriction site elimination using Pfu DNA polymerase PCR JOURNAL BioTechniques 25 (5), 772-774 (1998) PUBMED 9821576 REFERENCE 3 (bases 1 to 3714) AUTHORS Dennis JJ, Zylstra GJ. TITLE Direct Submission JOURNAL Submitted (12-AUG-1998) Biotechnology Center for Agriculture and the Environment, Cook College, Rutgers University, 59 Dudley Rd., New Brunswick, NJ 08901, USA REFERENCE 4 (bases 1 to 3714) TITLE Direct Submission REFERENCE 5 (bases 1 to 3714) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages: "2710-2715" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "BioTechniques"; date: "1998"; volume: "25"; issue: "5"; pages: "772-774" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (12-AUG-1998) Biotechnology Center for Agriculture and the Environment, Cook College, Rutgers University, 59 Dudley Rd., New Brunswick, NJ 08901, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..3714 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..51 /label=multiple cloning site cassette /note="multiple cloning site cassette" CDS 162..974 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDEAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" misc_feature 978..1028 /label=multiple cloning site cassette /note="multiple cloning site cassette" promoter complement(1034..1052) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1071..1087) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(1095..1111) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1119..1149) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1164..1185) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1473..2061) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2235..3092) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(3093..3197) /label=AmpR promoter primer_bind 3671..3687 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3690..3708 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.