Basic Vector Information
- Vector Name:
- p34S-Gm
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3617 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dennis JJ, Zylstra GJ.
- Promoter:
- Pc
p34S-Gm vector Vector Map
p34S-Gm vector Sequence
LOCUS 40924_2582 3617 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector p34S-Gm, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3617) AUTHORS Dennis JJ, Zylstra GJ. TITLE Plasposons: modular self-cloning minitransposon derivatives for rapid genetic analysis of gram-negative bacterial genomes JOURNAL Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998) PUBMED 9647854 REFERENCE 2 (bases 1 to 3617) AUTHORS Dennis JJ, Zylstra GJ. TITLE Direct Submission JOURNAL Submitted (30-APR-1998) Biotechnology Center for Agriculture and the Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley Rd., New Brunswick, NJ 08901-8520, USA REFERENCE 3 (bases 1 to 3617) TITLE Direct Submission REFERENCE 4 (bases 1 to 3617) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages: "2710-2715" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-APR-1998) Biotechnology Center for Agriculture and the Environment, Cook College, Rutgers University, Foran Hall, 59 Dudley Rd., New Brunswick, NJ 08901-8520, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..3617 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1..57) /label=MCS /note="pUC18/19 multiple cloning site" promoter 55..83 /label=Pc promoter /note="class 1 integron promoter" CDS 272..802 /codon_start=1 /label=GmR /note="gentamycin acetyltransferase" /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPRFEQPRS EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR EEVMHFDIDPSTAT" misc_feature 875..931 /label=MCS /note="pUC18/19 multiple cloning site" promoter complement(937..955) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(974..990) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(998..1014) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(1022..1052) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1067..1088) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1376..1964) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(2138..2995) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(2996..3100) /label=AmpR promoter primer_bind 3574..3590 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 3593..3611 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.