Basic Vector Information
- Vector Name:
- p17GFP(lox-Sm-E-Kn)-Tc
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7272 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV.
- Promoter:
- tetR/tetAs
p17GFP(lox-Sm-E-Kn)-Tc vector Map
p17GFP(lox-Sm-E-Kn)-Tc vector Sequence
LOCUS 40924_2433 7272 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector p17GFP(lox-Sm-E-Kn)-Tc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7272) AUTHORS Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV. TITLE Genetic tools for C. glutamicum JOURNAL Unpublished REFERENCE 2 (bases 1 to 7272) AUTHORS Gorshkova NV, Gak ER, Tokmakova IL, Mashko SV. TITLE Direct Submission JOURNAL Submitted (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow 117545, Russia REFERENCE 3 (bases 1 to 7272) TITLE Direct Submission REFERENCE 4 (bases 1 to 7272) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2014) Lab3, AGRI, 1st Dorozhny Proezd, 1-1, Moscow 117545, Russia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7272 /mol_type="other DNA" /organism="synthetic DNA construct" mobile_element complement(56..173) /mobile_element_type="transposon:Mu bacteriophage attR" /label=ttR protein_bind complement(280..313) /label=lox71 /note="Left element (LE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." protein_bind 359..392 /label=FRT (minimal) /note="supports FLP-mediated excision but not integration (Turan and Bode, 2011)" CDS complement(586..1377) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" protein_bind 1738..1785 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." regulatory complement(1991..2138) /regulatory_class="enhancer" CDS complement(2217..3053) /codon_start=1 /gene="strB" /product="StrB" /label=strB /note="streptomycin phosphotransferase" /protein_id="AKN19595.1" /translation="MFMPPVFPAHWHVSQPVLIADTFSSLVWKVSLPDGTPAIVKGLKP IEDIADELRGADYLVWRNGRGAVRLLGRENNLMLLEYAGERMLSHIVAEHGDYQATEIA AELMAKLYAASEEPLPSALLPIRDRFAALFQRARDDQNAGCQTDYVHAAIIADQMMSNA SELRGLHGDLHHENIMFSSRGWLVIDPVGLVGEVGFGAANMFYDPADRDDLCLDPRRIA QMADAFSRALDVDPRRLLDQAYAYGCLSAAWNADGEEEQRDLAIAAAIKQVRQTSY" gene complement(2217..3053) /gene="strB" /label=strB CDS complement(3053..3856) /codon_start=1 /gene="strA" /product="StrA" /label=strA /note="streptomycin phosphotransferase" /protein_id="AKN19596.1" /translation="MNRTNIFFGESHSDWLPVRGGESGDFVFRRGDGHAFAKIAPASRR GELAGERDRLIWLKGRGVACPEVINWQEEQEGACLVITAIPGVPAADLSGADLLKAWPS MGQQLGAVHSLSVDQCPFERRLSRMFGRAVDVVSRNAVNPDFLPDEDKSTPLHDLLARV ERELPVRLDQERTDMVVCHGDPCMPNFMVDPKTLQCTGLIDLGRLGTADRYADLALMIA NAEENWAAPDEAERAFAVLFNVLGIEAPDRERLAFYLRLDPLTWG" gene complement(3053..3856) /gene="strA" /label=strA protein_bind complement(3926..3959) /label=lox66 /note="Right element (RE) mutant of loxP (Araki et al., 2010). Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." CDS complement(3965..4657) /label=ZsGreen /note="Zoanthus green fluorescent protein (Matz et al., 1999)" primer_bind complement(4889..4905) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 5108..5167 /label=his operon terminator /note="This putative transcriptin terminator from the E. coli his operon has a 2-bp deletion introduced during synthesis. Its efficiency has not been determined." mobile_element complement(5179..5396) /mobile_element_type="transposon:Mu bacteriophage attL" /label=ttL rep_origin complement(5526..5918) /direction=LEFT /label=R6K gamma ori /note="gamma replication origin from E. coli plasmid R6K; requires the R6K initiator protein pi for replication" CDS complement(6008..7210) /label=TcR /note="tetracycline efflux protein" protein_bind complement(7219..7237) /label=tet operator /note="bacterial operator O2 for the tetR and tetA genes"
This page is informational only.