Basic Vector Information
- Vector Name:
- P-element_XP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10064 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E,
P-element_XP vector Map
P-element_XP vector Sequence
LOCUS 40924_2328 10064 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector P-element_XP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10064) AUTHORS Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E, Jakkula L, Joo D, Killpack K, Laufer A, Mazzotta J, Smith RD, Stevens LM, Stuber C, Tan LR, Ventura R, Woo A, Zakrajsek I, Zhao L, Chen F, Swimmer C, Kopczynski C, Duyk G, Winberg ML, Margolis J. TITLE A complementary transposon tool kit for Drosophila melanogaster using P and piggyBac JOURNAL Nat. Genet. 36 (3), 283-287 (2004) PUBMED 14981521 REFERENCE 2 (bases 1 to 10064) AUTHORS Dompe NA, Buchholz R, Miyazaki WY, Kopczynski C. TITLE Direct Submission JOURNAL Submitted (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, South San Francisco, CA 94083, USA REFERENCE 3 (bases 1 to 10064) TITLE Direct Submission REFERENCE 4 (bases 1 to 10064) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Genet."; date: "2004"; volume: "36"; issue: "3"; pages: "283-287" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, South San Francisco, CA 94083, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10064 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 597..644 /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." protein_bind 1390..1437 /label=FRT /bound_moiety="FLP recombinase from the Saccharomyces cerevisiae 2u plasmid" /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." gene complement(1633..5769) /label=mini-white /note="This modified version of the white gene lacks part of the first intron." misc_feature 7072..7304 /label=P element 3' end /note="P element 3' end" promoter 8106..8210 /label=AmpR promoter CDS 8211..9068 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 9242..9830 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.