P-element_XP vector (V009811)

Basic Vector Information

Vector Name:
P-element_XP
Antibiotic Resistance:
Ampicillin
Length:
10064 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E,

P-element_XP vector Map

P-element_XP10064 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000FRTFRTmini-whiteP element 3' endAmpR promoterAmpRori

P-element_XP vector Sequence

LOCUS       40924_2328       10064 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector P-element_XP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10064)
  AUTHORS   Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, 
            Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung 
            LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E, 
            Jakkula L, Joo D, Killpack K, Laufer A, Mazzotta J, Smith RD, 
            Stevens LM, Stuber C, Tan LR, Ventura R, Woo A, Zakrajsek I, Zhao L,
            Chen F, Swimmer C, Kopczynski C, Duyk G, Winberg ML, Margolis J.
  TITLE     A complementary transposon tool kit for Drosophila melanogaster 
            using P and piggyBac
  JOURNAL   Nat. Genet. 36 (3), 283-287 (2004)
  PUBMED    14981521
REFERENCE   2  (bases 1 to 10064)
  AUTHORS   Dompe NA, Buchholz R, Miyazaki WY, Kopczynski C.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, 
            South San Francisco, CA 94083, USA
REFERENCE   3  (bases 1 to 10064)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10064)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat. 
            Genet."; date: "2004"; volume: "36"; issue: "3"; pages: "283-287"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, South San 
            Francisco, CA 94083, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10064
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    597..644
                     /label=FRT
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     protein_bind    1390..1437
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     gene            complement(1633..5769)
                     /label=mini-white
                     /note="This modified version of the white gene lacks part
                     of the first intron."
     misc_feature    7072..7304
                     /label=P element 3' end
                     /note="P element 3' end"
     promoter        8106..8210
                     /label=AmpR promoter
     CDS             8211..9068
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     rep_origin      9242..9830
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.