Basic Vector Information
- Vector Name:
- miniTn4001-Puro-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5311 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Paetzold B, Carolis C, Ferrar T, Serrano L, Lluch-Senar M.
miniTn4001-Puro-1 vector Map
miniTn4001-Puro-1 vector Sequence
LOCUS 40924_1994 5311 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector miniTn4001-Puro-1, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5311) AUTHORS Paetzold B, Carolis C, Ferrar T, Serrano L, Lluch-Senar M. TITLE In situ overlap and sequence synthesis during DNA assembly JOURNAL ACS Synth Biol 2 (12), 750-755 (2013) PUBMED 24161008 REFERENCE 2 (bases 1 to 5311) AUTHORS Paetzold B. TITLE Direct Submission JOURNAL Submitted (21-MAR-2013) EMBL-CRG Systems Biology Research Unit, Centre for Genomic Regulation, Dr. Aiguader 88, Barcelona 08003, Spain REFERENCE 3 (bases 1 to 5311) TITLE Direct Submission REFERENCE 4 (bases 1 to 5311) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth Biol"; date: "2013"; volume: "2"; issue: "12"; pages: "750-755" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (21-MAR-2013) EMBL-CRG Systems Biology Research Unit, Centre for Genomic Regulation, Dr. Aiguader 88, Barcelona 08003, Spain" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5311 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(2..18) /label=SK primer /note="common sequencing primer, one of multiple similar variants" mobile_element complement(27..52) /mobile_element_type="insertion sequence:IS256" /label=insertion sequence:IS256 promoter complement(74..92) /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(113..129) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(137..153) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(161..191) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(206..227) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(515..1103) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1277..2134) /label=AmpR /note="beta-lactamase" promoter complement(2135..2239) /label=AmpR promoter rep_origin complement(2265..2720) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 2862..2878 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 2888..2906 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 3008..4180 /codon_start=1 /product="transposase" /label=transposase /protein_id="AHL28656.1" /translation="MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEY IQAKEYERTENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALM ASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPY LMTDVLYIKVREENRVLSKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKER GLQGTELVISDAHKGLVSAIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGI FKFTDINLAREAKNRLIHDYIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLI ERLNQEVRRREKIIRIFPNQTSANRLIGAVLMDLHDEWIYSSRKYINFDK" mobile_element 4185..4210 /mobile_element_type="insertion sequence:IS256" /label=insertion sequence:IS256 primer_bind 4222..4238 /label=KS primer /note="common sequencing primer, one of multiple similar variants" regulatory 4287..4296 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 4627..5223 /label=PuroR /note="puromycin N-acetyltransferase"
This page is informational only.