Basic Vector Information
- Vector Name:
- miniTn4001-Puro-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5311 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Paetzold B, Carolis C, Ferrar T, Serrano L, Lluch-Senar M.
miniTn4001-Puro-1 vector Map
miniTn4001-Puro-1 vector Sequence
LOCUS 40924_1994 5311 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector miniTn4001-Puro-1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5311)
AUTHORS Paetzold B, Carolis C, Ferrar T, Serrano L, Lluch-Senar M.
TITLE In situ overlap and sequence synthesis during DNA assembly
JOURNAL ACS Synth Biol 2 (12), 750-755 (2013)
PUBMED 24161008
REFERENCE 2 (bases 1 to 5311)
AUTHORS Paetzold B.
TITLE Direct Submission
JOURNAL Submitted (21-MAR-2013) EMBL-CRG Systems Biology Research Unit,
Centre for Genomic Regulation, Dr. Aiguader 88, Barcelona 08003,
Spain
REFERENCE 3 (bases 1 to 5311)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5311)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth
Biol"; date: "2013"; volume: "2"; issue: "12"; pages: "750-755"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-MAR-2013) EMBL-CRG Systems Biology Research Unit, Centre for
Genomic Regulation, Dr. Aiguader 88, Barcelona 08003, Spain"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5311
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind complement(2..18)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
mobile_element complement(27..52)
/mobile_element_type="insertion sequence:IS256"
/label=insertion sequence:IS256
promoter complement(74..92)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(113..129)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(137..153)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(161..191)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(206..227)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(515..1103)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1277..2134)
/label=AmpR
/note="beta-lactamase"
promoter complement(2135..2239)
/label=AmpR promoter
rep_origin complement(2265..2720)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 2862..2878
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 2888..2906
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 3008..4180
/codon_start=1
/product="transposase"
/label=transposase
/protein_id="AHL28656.1"
/translation="MTQVHFTLKSEEIQSIIEYSVKDDVSKNILTTVFNQLMENQRTEY
IQAKEYERTENRQSQRNGYYERSFTTRVGTLELKVPRTRDGHFSPTVFERYQRNEKALM
ASMLEMYVSGVSTRKVSKIVEELCGKSVSKSFVSSLTEQLEPMVNEWQNRLLSEKNYPY
LMTDVLYIKVREENRVLSKSCHIAIGITKDGDREIIGFMIQSGESEETWTTFFEYLKER
GLQGTELVISDAHKGLVSAIRKSFTNVSWQRCQVHFLRNIFTTIPKKNSKSFREAVKGI
FKFTDINLAREAKNRLIHDYIDQPKYSKACASLDDGFEDAFQYTVQGNSHNRLKSTNLI
ERLNQEVRRREKIIRIFPNQTSANRLIGAVLMDLHDEWIYSSRKYINFDK"
mobile_element 4185..4210
/mobile_element_type="insertion sequence:IS256"
/label=insertion sequence:IS256
primer_bind 4222..4238
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
regulatory 4287..4296
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 4627..5223
/label=PuroR
/note="puromycin N-acetyltransferase"
This page is informational only.