Basic Vector Information
- Vector Name:
- mini-CTX2
- Antibiotic Resistance:
- Tetracycline
- Length:
- 6755 bp
- Type:
- Integration vector
- Replication origin:
- ori
- Source/Author:
- Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
- Promoter:
- trc
mini-CTX2 vector Map
mini-CTX2 vector Sequence
LOCUS 40924_1979 6755 bp DNA circular SYN 17-DEC-2018 DEFINITION Integration vector mini-CTX2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6755) AUTHORS Hoang TT, Kutchma AJ, Becher A, Schweizer HP. TITLE A site-specific gene integration system for Pseudomonas aeruginosa JOURNAL Unpublished REFERENCE 2 (bases 1 to 6755) AUTHORS Hoang TT, Kutchma AJ, Becher A, Schweizer HP. TITLE Direct Submission JOURNAL Submitted (06-APR-1999) Microbiology, Colorado State University, Fort Collins, CO 80523, USA REFERENCE 3 (bases 1 to 6755) TITLE Direct Submission REFERENCE 4 (bases 1 to 6755) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (06-APR-1999) Microbiology, Colorado State University, Fort Collins, CO 80523, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6755 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 827..845 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase" misc_feature 858..965 /label=MCS /note="pBluescript multiple cloning site" promoter complement(974..992) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind complement(1166..1213) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." oriT complement(1420..1528) /direction=LEFT /label=oriT /note="incP origin of transfer" protein_bind complement(2877..2893) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2901..2930) /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" CDS complement(3174..4253) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(4254..4331) /label=lacI promoter misc_feature 4517..4657 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(4843..5431) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5511..6698) /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" promoter complement(join(6746..6755,1..19)) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene"
This page is informational only.