Basic Vector Information
- Vector Name:
- LUCTRAP
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5990 bp
- Type:
- Cloning vector
- Replication origin:
- pSa ori
- Host:
- Plants
- Source/Author:
- Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C.
- Promoter:
- NOS
LUCTRAP vector Map
LUCTRAP vector Sequence
LOCUS 40924_1874 5990 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector LUCTRAP, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5990) AUTHORS Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C. TITLE LucTrap vectors are tools to generate luciferase fusions for the quantification of transcript and protein abundance in vivo JOURNAL Plant Physiol. 141 (1), 3-14 (2006) PUBMED 16684932 REFERENCE 2 (bases 1 to 5990) AUTHORS Calderon LIA. V, Kuhnle C, Dohmann EMN., Li H, Schwechheimer C. TITLE Direct Submission JOURNAL Submitted (24-MAY-2005) Developmental Genetics, Centre for Plant Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany REFERENCE 3 (bases 1 to 5990) TITLE Direct Submission REFERENCE 4 (bases 1 to 5990) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Physiol."; date: "2006"; volume: "141"; issue: "1"; pages: "3-14" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-MAY-2005) Developmental Genetics, Centre for Plant Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5990 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 320..1132 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1236..1824 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(1915..1939) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" CDS 1970..3619 /codon_start=1 /label=luciferase /note="firefly luciferase" /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV" primer_bind complement(3777..3793) /label=KS primer /note="common sequencing primer, one of multiple similar variants" promoter complement(3819..3837) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(3844..3860) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 4107..4286 /label=NOS promoter /note="nopaline synthase promoter" CDS 4320..5111 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" terminator 5154..5405 /label=NOS terminator /note="nopaline synthase terminator and poly(A) signal" misc_feature complement(5429..5451) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA (truncated)" rep_origin complement(join(5584..5990,1..29)) /direction=LEFT /label=pSa ori /note="origin of replication from bacterial plasmid pSa"
This page is informational only.